KEGG   Caldicellulosiruptor bescii: Athe_2754Help
Entry
Athe_2754         CDS       T00857                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ate  Caldicellulosiruptor bescii
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ate00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Athe_2754
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Athe_2754
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Athe_2754
Enzymes [BR:ate01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Athe_2754
Exosome [BR:ate04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Athe_2754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2904090..2905733
Genome map
AA seq 547 aa AA seqDB search
MKNVFLRRKNILISVILILCLILSTLSFAQQDINDNENRVKNVILMIPDGMTIAHITLAR
WYQDGKPLAMDELACGLVRTYSANNPITDSAPAATAYATGYKTQNRYLSIYPEIVSMPGV
GQVEEKDFYKPIITILEAAKNLGKSTGLVFTCQFPHATPAAFASHTDNRNDYESIAEQMV
YNHVDVVLGGGYKYIDKNQRKDKEDLAGYLKQNGIFVTTNWHDAKNFLGKKIWGLFAQDA
MQYDFDRNGTGEPSLAEMTQKALQILSKNRNGFFLMVEGSQIDWASHANDPVGVVSEVLA
FDKAVKVALDFAKSRDDTAVIIAPDHTNGGMTLGIGTTSIDSILLNHFLRYIREATRTAA
VAEKILGNNRTDENIKKVVSQYYGIDNLTQDEINAIKNAPQGRLNYVLGPIISKRSYIGW
TSNEHTGEEVVLYAYHPKDYIPRGVIENTEVCDYMAEILGIDLGSFNENAYISNIDLEEK
GYDVSIDTSNPSNIQLVINKGSKTYIIPQNKNVVLEGYNQYKLKYVSVYIPSAKRFFVSS
EIESLIK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtttttttgagaagaaaaaatatacttatttcagtaattttaatcctatgt
ctaattttatcaactctttcatttgctcaacaagatataaacgataatgaaaatagagtc
aaaaatgttattttaatgattcctgatggtatgacaatagcccacataacgcttgctcgc
tggtatcaagatggaaaacctttggcaatggacgaacttgcctgtgggcttgtaagaaca
tattcagcaaacaatccaattacagactcagcaccagctgcaacagcttatgctacaggg
tataaaacccaaaacaggtacctttccatatatcctgagattgtttcaatgccaggagtt
gggcaagtagaggaaaaagatttttataagcctataataactatattggaagcagctaaa
aatttaggaaaatcaacaggtcttgttttcacatgccagtttccgcacgcaacacctgct
gcttttgcctcacatacagacaacagaaatgattatgaatctatagccgagcagatggtt
tataaccatgttgatgttgtgctcggtggagggtacaaatacattgacaaaaatcagaga
aaagacaaggaagatttggcaggttacttgaagcaaaatggcatttttgttacaacaaac
tggcatgatgcaaaaaactttttaggaaagaaaatctggggactttttgcccaggacgca
atgcaatatgattttgacagaaatggcacaggtgaaccgtctttagcagagatgactcaa
aaagcactccagattctgtccaagaatagaaacggatttttcttaatggttgaaggcagc
caaattgactgggcatcacatgcaaacgaccccgttggagttgtatcagaggttttggca
tttgacaaggctgtcaaagtagctttagactttgcaaagtcaagagatgatacagctgta
attattgcaccagaccataccaatggtggtatgacacttggaataggaacaacttcaatt
gacagtatactattgaatcattttctgaggtacatcagagaagcaacaagaacggcagca
gtagcagaaaaaatacttggaaacaatagaacagatgaaaatatcaaaaaggtagtatca
cagtattatggcattgacaatctcacacaggatgaaataaatgcaatcaaaaacgctcct
cagggaaggttaaactatgtattaggtccaattataagcaagcgatcatacattggttgg
acttcaaatgaacacacaggtgaagaggttgttttatatgcatatcacccaaaagattac
attccaagaggtgttattgaaaacacagaggtctgtgactacatggcagaaattcttggt
attgaccttggaagctttaatgaaaatgcatatatctcaaacattgacttagaagaaaaa
ggatatgatgtttccattgacacaagtaacccgtcaaatattcagcttgtaataaacaaa
ggaagtaaaacgtacatcatcccgcaaaacaaaaatgttgttttagaaggttataatcag
tataagttaaaatatgtaagtgtgtacattccaagtgcgaaaaggttctttgtatcaagt
gagatagaaagtttgattaaatga

DBGET integrated database retrieval system