KEGG   Arabidopsis thaliana (thale cress): AT1G01110Help
Entry
AT1G01110         CDS       T00041                                 

Gene name
IQD18
Definition
(RefSeq) IQ-domain 18
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
1
AA seq 527 aa AA seqDB search
MGKKNGSSSWLTAVKRAFRSPTKKDHSNDVEEDEEKKREKRRWFRKPATQESPVKSSGIS
PPAPQEDSLNVNSKPSPETAPSYATTTPPSNAGKPPSAVVPIATSASKTLAPRRIYYARE
NYAAVVIQTSFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVL
DQRKRLSHDGSRKSAFSDSHAVFESRYLQDLSDRQSMSREGSSAAEDWDDRPHTIDAVKV
MLQRRRDTALRHDKTNLSQAFSQKMWRTVGNQSTEGHHEVELEEERPKWLDRWMATRPWD
KRASSRASVDQRVSVKTVEIDTSQPYSRTGAGSPSRGQRPSSPSRTSHHYQSRNNFSATP
SPAKSRPILIRSASPRCQRDPREDRDRAAYSYTSNTPSLRSNYSFTARSGCSISTTMVNN
ASLLPNYMASTESAKARIRSHSAPRQRPSTPERDRAGLVKKRLSYPVPPPAEYEDNNSLR
SPSFKSVAGSHFGGMLEQQSNYSSCCTESNGVEISPASTSDFRNWLR
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaaagaacggctcttcttcttggctcaccgctgtaaagcgagctttccgatct
ccgacgaagaaagatcatagtaatgacgtcgaagaagatgaagaaaagaagagagagaag
agacggtggtttagaaaaccggcgactcaagaatctccggtgaagtcttccggtatctct
ccaccagcacctcaggaagattcacttaacgtaaactcaaaaccctctccggagacagca
ccgagttacgcaactacgacgccgccatccaacgccggtaaacccccgtccgccgtagtc
cccatcgccacgtcagcatctaagacactcgcaccgaggcggatttattacgcaagagaa
aattacgctgctgttgtcatccagacttctttcagaggatatttggcaagaagagcatta
agagcattaaaagggttagtgaagctacaagcattggtgaggggacataatgtgagaaag
caagctaaaatgacattaaggtgtatgcaagctctggttcgagtccagtctcgtgtgctt
gaccaacgcaaacgcttgtctcatgacggtagtcgcaaatccgcgttcagtgactctcac
gctgtttttgaatctcgctatcttcaagatttgtcagatcgacaatccatgtcaagagaa
ggaagcagcgccgcggaagattgggatgaccgaccacacacgatagacgcagtgaaagtg
atgctacaacggagacgggacacagcattgagacatgacaagactaatttgtcacaagct
ttctctcaaaagatgtggaggacggttggtaaccaatccacggaaggacaccacgaggta
gaacttgaagaggaaaggccaaaatggcttgaccggtggatggctactagaccgtgggat
aaacgagctagtagtagagcttcggttgaccaaagggtttcagttaaaaccgttgaaatc
gacacttctcagccttactcaagaacaggagcaggaagcccgagtcgtggccaaagacct
agttccccatcaagaactagccaccattaccaatcccgcaataatttctcagccactcca
tctccggctaagtctagaccaatacttattcggtcagctagtccacggtgccagagagac
ccgagggaagaccgtgaccgagcagcttatagttatacatcaaacacaccaagcttgaga
tccaattatagtttcacagctaggagtggatgtagcattagtaccacaatggttaataat
gcatcattgttgcctaattacatggcgagtacagagtcagctaaagcgaggatccggtct
catagtgcaccgaggcaacggccctcaactcccgagagggaccgtgcgggtttggtcaag
aaacggctctcgtatccggtaccaccgccagcggagtatgaggacaataatagcttaagg
agtccaagctttaagagtgtggctggttcacattttggtggaatgttagagcagcaatcg
aattactcttcatgttgcactgagtctaacggtgttgagatctctccagcttctactagt
gactttaggaattggcttagatga

DBGET integrated database retrieval system