KEGG   Arabidopsis thaliana (thale cress): AT3G11670Help
Entry
AT3G11670         CDS       T00041                                 

Gene name
DGD1
Definition
digalactosyldiacylglycerol synthase 1
Orthology
K09480  
digalactosyldiacylglycerol synthase [EC:2.4.1.241]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AT3G11670 (DGD1)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.241  digalactosyldiacylglycerol synthase
     AT3G11670 (DGD1)
Glycosyltransferases [BR:ath01003]
 Glycan extension
  Glycolipid
   AT3G11670 (DGD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 808 aa AA seqDB search
MVKETLIPPSSTSMTTGTSSSSSLSMTLSSTNALSFLSKGWREVWDSADADLQLMRDRAN
SVKNLASTFDREIENFLNNSARSAFPVGSPSASSFSNEIGIMKKLQPKISEFRRVYSAPE
ISRKVMERWGPARAKLGMDLSAIKKAIVSEMELDERQGVLEMSRLRRRRNSDRVRFTEFF
AEAERDGEAYFGDWEPIRSLKSRFKEFEKRSSLEILSGFKNSEFVEKLKTSFKSIYKETD
EAKDVPPLDVPELLACLVRQSEPFLDQIGVRKDTCDRIVESLCKCKSQQLWRLPSAQASD
LIENDNHGVDLDMRIASVLQSTGHHYDGGFWTDFVKPETPENKRHVAIVTTASLPWMTGT
AVNPLFRAAYLAKAAKQSVTLVVPWLCESDQELVYPNNLTFSSPEEQESYIRKWLEERIG
FKADFKISFYPGKFSKERRSIFPAGDTSQFISSKDADIAILEEPEHLNWYYHGKRWTDKF
NHVVGIVHTNYLEYIKREKNGALQAFFVNHVNNWVTRAYCDKVLRLSAATQDLPKSVVCN
VHGVNPKFLMIGEKIAEERSRGEQAFSKGAYFLGKMVWAKGYRELIDLMAKHKSELGSFN
LDVYGNGEDAVEVQRAAKKHDLNLNFLKGRDHADDALHKYKVFINPSISDVLCTATAEAL
AMGKFVVCADHPSNEFFRSFPNCLTYKTSEDFVSKVQEAMTKEPLPLTPEQMYNLSWEAA
TQRFMEYSDLDKILNNGEGGRKMRKSRSVPSFNEVVDGGLAFSHYVLTGNDFLRLCTGAT
PRTKDYDNQHCKDLNLVPPHVHKPIFGW
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaggaaactctaattcctccgtcatctacgtcaatgacgaccggaacatcttct
tcttcgtctctttcaatgacgttatcctcaacaaacgcgttatcgtttttgtcgaaagga
tggagagaggtatgggattcagcagatgcggatttgcagctgatgcgagacagagctaac
tctgttaagaatctagcatcaacgttcgatagagagatcgagaatttcctcaataactcg
gcgaggtctgcgtttcccgttggttcaccatcggcgtcgtctttctcaaatgaaattggt
atcatgaagaagcttcagccgaagatttcggagtttcgtagggtttattcggcgccggag
attagtcgcaaggttatggagagatggggacctgcgagagcgaagcttggaatggatcta
tcggcgattaagaaggcgattgtgtctgagatggaattggatgagcgtcagggagttttg
gagatgagtagattgaggagacggcgtaatagtgatagggttaggtttacggagtttttc
gcggaggctgagagagatggagaagcttatttcggtgattgggaaccgattaggtctttg
aagagtagatttaaagagtttgagaaacgaagctcgttagaaatattgagtggattcaag
aacagtgaatttgttgagaagctcaaaaccagctttaaatcaatttacaaagaaactgat
gaggctaaggatgtccctccgttggatgtacctgaactgttggcatgtttggttagacaa
tctgaaccttttcttgatcagattggtgttagaaaggatacatgtgaccgaatagtagaa
agcctttgcaaatgcaagagccaacaactttggcgtctgccatctgcacaagcatccgat
ttaattgaaaatgataaccatggagttgatttggatatgaggatagccagtgttcttcaa
agcacaggacaccattatgatggtgggttttggactgattttgtgaagcctgagacaccg
gaaaacaaaaggcatgtggcaattgttacaacagctagtcttccttggatgaccggaaca
gctgtaaatccgctattcagagcggcgtatttggcaaaagctgcaaaacagagtgttact
ctcgtggttccttggctctgcgaatctgatcaagaactagtgtatccaaacaatctcacc
ttcagctcacctgaagaacaagagagttatatacgtaaatggttggaggaaaggattggt
ttcaaggctgattttaaaatctccttttacccaggaaagttttcaaaagaaaggcgcagc
atatttcctgctggtgacacttctcaatttatatcgtcaaaagatgctgacattgctata
cttgaagaacctgaacatctcaactggtattatcacggcaagcgttggactgataaattc
aaccatgttgttggaattgtccacacaaactacttagagtacatcaagagggagaagaat
ggagctcttcaagcattttttgtgaaccatgtaaacaattgggtcacacgagcgtattgt
gacaaggttcttcgcctctctgcggcaacacaagatttaccaaagtctgttgtatgcaat
gtccatggtgtcaatcccaagttccttatgattggggagaaaattgctgaagagagatcc
cgtggtgaacaagctttctcaaaaggtgcatacttcttaggaaaaatggtgtgggctaaa
ggatacagagaactaatagatctgatggctaaacacaaaagcgaacttgggagcttcaat
ctagatgtatatgggaacggtgaagatgcagtcgaggtccaacgtgcagcaaagaaacat
gacttgaatctcaatttcctcaaaggaagggaccacgctgacgatgctcttcacaagtac
aaagtgttcataaaccccagcatcagcgatgttctatgcacagcaaccgcagaagcacta
gccatggggaagtttgtggtgtgtgcagatcacccttcaaacgaattctttagatcattc
ccgaactgcttaacttacaaaacatccgaagactttgtgtccaaagtgcaagaagcaatg
acgaaagagccactacctctcactcctgaacaaatgtacaatctctcttgggaagcagca
acacagaggttcatggagtattcagatctcgataagatcttaaacaatggagagggagga
aggaagatgcgaaaatcaagatcggttccgagctttaacgaggtggtcgatggaggattg
gcattctcacactatgttctaacagggaacgatttcttgagactatgcactggagcaaca
ccaagaacaaaagactatgataatcaacattgcaaggatctgaatctcgtaccacctcac
gttcacaagccaatcttcggctggtag

DBGET integrated database retrieval system