KEGG   Arabidopsis thaliana (thale cress): AT4G00550Help
Entry
AT4G00550         CDS       T00041                                 

Gene name
DGD2
Definition
(RefSeq) digalactosyl diacylglycerol deficient 2
  KO
K09480  digalactosyldiacylglycerol synthase [EC:2.4.1.241]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00561  Glycerolipid metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AT4G00550 (DGD2)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.241  digalactosyldiacylglycerol synthase
     AT4G00550 (DGD2)
Glycosyltransferases [BR:ath01003]
 Glycan extension
  Glycolipid
   AT4G00550 (DGD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Fis1_TPR_N
Motif
Other DBs
NCBI-GeneID: 827960
NCBI-ProteinID: NP_001329549
MIPS: AT4G00550.1
TAIR: AT4G00550
Araport: AT4G00550
UniProt: Q8W1S1 A0A178V709
Position
4
AA seq 473 aa AA seqDB search
MTNQQEQHIAIFTTASIPWLTGTAVNPLFRAAYLANDGERRVTLVIPWLTLKHQKLVYPN
SITFSSPSEQEAYVRQWLEERVSFRLAFEIRFYPGKFAIDKRSILPVGDISDAIPDEEAD
IAVLEEPEHLTWFHHGQKWKTKFNYVIGIVHTNYLEYVKREKQGRVKAFFLKYLNSWVVG
IYCHKVIRLSAATQEYPKSIVCNVHGVNPKFLEIGLRKLEQQKLQEQPFTKGAYYIGKMV
WSKGYKELLKLLEKHQKELAELEVDLYGDGEDSEEIKEAARKLDLTVNVYPGRDHADSLF
HNYKVFLNPSTTDVVCTTTAEALAMGKIVVCANHISNKFFKQFPNCRTYDDGQGFVRATL
KALGEQPSQLTEQQRHELSWEAATQRFIKVSDLNRLSRADSNLSKRSVFASSSISVGKNL
EDMSAYIHFLASGFEASRTAFGAIPGSLQPDEELCRDLGLSLNTPSPNTRKQD
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgactaatcagcaggagcaacacattgcgatatttacaacagctagtattccatggctt
acgggaactgctgttaatcctctcttccgtgctgcctaccttgcaaatgatggggaaaga
cgggtcacgttggtgattccatggctgactttgaagcaccaaaagcttgtctacccaaat
agcatcacttttagttccccgtcagagcaagaagcttatgtccgccagtggcttgaggag
agagtctcttttcgtttagcctttgagatacgtttctatcctggaaagtttgctattgac
aaaaggagtattcttcctgttggggatatatctgatgccattcctgatgaagaggcagac
attgctgtcctcgaggagcctgagcatctcacatggtttcatcatggccaaaaatggaaa
actaagttcaactacgtcataggaatcgtacacactaactacttggaatacgttaaaaga
gagaaacaaggccgtgtcaaagcatttttcctcaaatacttaaatagttgggttgttggc
atttactgccacaaggtaatcaggttatctgctgcgactcaagaataccctaaatctata
gtctgcaatgttcatggcgtcaaccctaaatttctcgaaattgggttgagaaaactagaa
cagcagaagctccaggagcagcccttcactaaaggcgcatactacattggtaagatggtc
tggagcaaagggtacaaggagcttcttaaactacttgagaaacaccaaaaggaacttgcc
gagttagaggttgatttatacggtgatggagaggactctgaagagatcaaagaagcagcc
cgaaaactcgacttgacggttaatgtttacccaggacgtgatcacgctgactcgctattt
cacaactataaagtgtttctcaaccccagcacgacagacgttgtgtgtacaacaactgca
gaagccttggcgatgggaaaaatagtagtatgcgcgaatcacatatcgaacaagttcttc
aaacagtttcccaactgcagaacctatgacgatggacaaggttttgtaagagccacgctc
aaggctcttggggaacaaccatcgcaacttacagagcaacaaaggcatgaactatcatgg
gaagctgctacacaacggtttataaaagtctctgatctgaaccggttatcaagagctgat
tcgaacttgtcaaagagaagtgtgtttgcgtcatcttcgattagtgtggggaaaaacttg
gaggatatgtcagcgtatattcatttcttggcgtctggatttgaagcttccagaacagct
tttggtgctatacctggaagcttgcagcccgatgaagagttatgtagagatcttggtttg
tctctcaacactccttccccaaatactcgcaagcaagattga

DBGET integrated database retrieval system