KEGG   Arabidopsis thaliana (thale cress): AT4G01970Help
Entry
AT4G01970         CDS       T00041                                 

Gene name
STS
Definition
stachyose synthase
Orthology
K06611  
stachyose synthetase [EC:2.4.1.67]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AT4G01970 (STS)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.67  galactinol---raffinose galactosyltransferase
     AT4G01970 (STS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
4
AA seq 876 aa AA seqDB search
MAPLHESLSSINDVIESKPLFVPITKPILQPNSFNLSEGSLCAKDSTPILFDVPQNVTFT
PFSSHSISTDAPLPILLRVQANAHKGGFLGFTKESPSDRLTNSLGRFEDREFLSLFRFKM
WWSTAWIGKSGSDLQAETQWVMLKIPEIDSYVAIIPTIEGAFRASLTPGEKGNVLICAES
GSTKVKESSFKSIAYIHICDNPYNLMKEAFSALRVHMNTFKLLEEKKLPKIVDKFGWCTW
DACYLTVDPATIWTGVKEFEDGGVCPKFVIIDDGWQSINFDGDELDKDAENLVLGGEQMT
ARLTSFKECKKFRNYKGGSFITSDASHFNPLKPKMLIYKATERIQAIILRRKLVKESGEQ
DLTELDEKIKILSEELNAMFDEVEKEESLGSDDVSGSGMAAFTKDLRLRFKSLDDIYVWH
ALCGAWNGVRPETMMDLKAKVAPFELSPSLGATMADLAVDKVVEAGIGLVHPSKAHEFYD
SMHSYLASVGVTGAKIDVFQTLESLAEEHGGRVELAKAYYDGLTESMIKNFNGTDVIASM
QQCNEFFFLATKQISIGRVGDDFWWQDPYGDPQGVYWLQGVHMIHCSYNSIWMGQMIQPD
WDMFQSDHVCAEYHAASRAICGGPVYLSDHLGKASHNFDLIKKLAFFDGTIPRCVHYALP
TRDSLFKNPLFDKESILKIFNFNKFGGVIGTFNCQGAGWSPEEHRFKGYKECYTTVSGTV
HVSDIEWDQNPEAAGSQVTYTGDYLVYKQQSEEILFMNSKSEAMKITLEPSAFDLLSFVP
VTELVSSGVRFAPLGLINMFNCVGTVQDMKVTGDNSIRVDVKGEGRFMAYSSSAPVKCYL
NDKEAEFKWEEETGKLSFFVPWVEESGGISHLSFTF
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atggctccacttcacgaatctctgtcatcaatcaacgatgtaatcgaatccaaacctctt
tttgttccaataactaagccaatcttgcagccaaactcatttaacctatccgaagggtct
ctctgtgccaaagactctactccaatcctctttgatgttcctcaaaacgtaactttcaca
ccattctcatctcactccatatccactgatgctcctctcccaatcctcctccgagttcaa
gccaacgctcacaaaggagggtttctcggattcaccaaagaatcaccctctgatcgtctc
acaaactccttgggaagattcgaagacagagagtttctcagtcttttccggttcaaaatg
tggtggtcgacggcttggatcgggaaatcagggtcggatcttcaagccgagactcagtgg
gtgatgctaaagattcctgagatcgattcctacgtggccatcataccaaccattgaagga
gcttttagggcttcacttactcctggtgagaaaggtaatgtcttgatttgtgcagagagt
ggctcaactaaagtaaaagagtcatctttcaaatccattgcctacattcacatttgtgac
aacccctataacctcatgaaagaggcttttagtgcacttcgtgttcatatgaacactttc
aagcttctagaagagaagaagcttccgaaaatcgtcgataagtttggatggtgcacttgg
gatgcttgctacttgaccgttgatcctgcaaccatttggactggagttaaggagtttgaa
gatggtggggtgtgtccgaagtttgtcatcattgatgatggatggcaaagtattaacttt
gatggtgatgagctagacaaagacgctgagaatcttgttcttggtggggagcaaatgact
gcgaggcttaccagcttcaaggagtgtaagaagtttagaaactataaaggtggatccttt
ataacatctgatgcatctcacttcaatcctctcaagccgaagatgcttatctacaaagcg
accgagcgaattcaggcgattatattgagacggaagttggttaaggagtctggggaacaa
gatctgaccgaacttgatgaaaagatcaagattttgagtgaagaactcaatgcaatgttt
gatgaggttgagaaagaagagtctttgggttctgatgatgtttctggctcaggtatggcg
gctttcacaaaggatttgaggttaaggtttaagagtttagatgatatatatgtgtggcat
gctctttgtggtgcttggaatggtgttaggcctgaaaccatgatggatttgaaggccaag
gttgctccttttgagctttcacctagtctaggcgctacgatggctgatctcgcagtcgac
aaggttgtagaagctgggattggtcttgttcatccttctaaagctcatgaattctacgac
tcgatgcactcttatcttgctagtgttggtgttacaggagccaagattgatgttttccaa
accttggagtcactagcagaagaacatggaggacgagtggagcttgctaaagcttactac
gatggtctgaccgaatccatgatcaagaattttaatggaactgatgtcattgcgagtatg
caacagtgcaatgagttcttcttccttgccacaaagcaaatctctattggcagagttggt
gatgatttttggtggcaagacccatatggtgacccacaaggagtatattggctacaagga
gttcacatgattcactgttcttacaacagtatttggatgggtcaaatgattcaaccagat
tgggacatgttccaatcagaccatgtctgtgccgagtaccacgccgcatctcgagccatt
tgcggtgggcctgtctatctcagtgaccatcttggcaaagcctcacataactttgatctc
atcaagaaacttgctttctttgatggtaccatcccaaggtgtgtccactatgctcttccc
actagagattcgctcttcaagaaccctttgtttgacaaagagtcaatcctcaagatcttc
aacttcaacaagtttggaggagtgattggaacatttaactgtcaaggtgctgggtggagc
ccagaggagcataggttcaaaggatacaaagaatgttacacgacagtttcgggaacagtt
catgtctcggacattgaatgggatcagaatccagaagctgcaggctctcaggtgacctac
actggagattacttggtttacaagcaacaatctgaagaaatccttttcatgaactcgaaa
tcagaagcgatgaagataacccttgagccatccgcgtttgacctgttgagtttcgtgcca
gtcacggaacttgtaagttcaggggttagattcgcacctctagggttgatcaacatgttc
aactgcgtcggaacagtccaagacatgaaggttactggtgataacagcataagagtggac
gtgaaaggcgaaggaagattcatggcgtattcgagttcagctccggtgaagtgttacttg
aacgacaaggaagctgagtttaagtgggaagaagaaactggtaaactcagtttctttgtt
ccttgggttgaagaatctggtggcatctctcatctgtctttcaccttttaa

DBGET integrated database retrieval system