KEGG   Arabidopsis thaliana (thale cress): AT5G40390Help
Entry
AT5G40390         CDS       T00041                                 

Gene name
SIP1
Definition
putative galactinol--sucrose galactosyltransferase 5
Orthology
K06617  
raffinose synthase [EC:2.4.1.82]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AT5G40390 (SIP1)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.82  galactinol---sucrose galactosyltransferase
     AT5G40390 (SIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 783 aa AA seqDB search
MASPCLTKSDSGINGVDFTEKFRLEDSTLLANGQVVLTDVPVNVTLTSSPYLVDKDGVPL
DVSAGSFIGFNLDGEPKSHHVASIGKLKNIRFMSIFRFKVWWTTHWVGSNGRDIENETQI
IILDQSGSDSGPGSGSGRPYVLLLPLLEGSFRSSFQSGEDDDVAVCVESGSTEVTGSEFR
QIVYVHAGDDPFKLVKDAMKVIRVHMNTFKLLEEKSPPGIVDKFGWCTWDAFYLTVNPDG
VHKGVKCLVDGGCPPGLVLIDDGWQSIGHDSDGIDVEGMNITVAGEQMPCRLLKFEENHK
FKDYVSPKDQNDVGMKAFVRDLKDEFSTVDYIYVWHALCGYWGGLRPEAPALPPSTIIRP
ELSPGLKLTMEDLAVDKIIETGIGFASPDLAKEFYEGLHSHLQNAGIDGVKVDVIHILEM
LCQKYGGRVDLAKAYFKALTSSVNKHFNGNGVIASMEHCNDFMFLGTEAISLGRVGDDFW
CTDPSGDPNGTFWLQGCHMVHCAYNSLWMGNFIQPDWDMFQSTHPCAEFHAASRAISGGP
IYISDCVGKHDFDLLKRLVLPNGSILRCEYYALPTRDRLFEDPLHDGKTMLKIWNLNKYT
GVIGAFNCQGGGWCRETRRNQCFSECVNTLTATTSPKDVEWNSGSSPISIANVEEFALFL
SQSKKLLLSGLNDDLELTLEPFKFELITVSPVVTIEGNSVRFAPIGLVNMLNTSGAIRSL
VYNDESVEVGVFGAGEFRVYASKKPVSCLIDGEVVEFGYEDSMVMVQVPWSGPDGLSSIQ
YLF
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgccgtgtttgaccaagtccgattccggtatcaatggcgttgactttaccgaa
aaattccggttagaagattccactctcttagccaatggtcaagtcgtcttaaccgatgtt
ccggttaacgttactctcacctcttcaccttacttagtcgacaaagacggtgtaccactc
gacgtctctgccggttcattcatcgggtttaacctcgacggagagcccaaaagccaccac
gtggcatccatcggaaaactcaagaacattcgtttcatgagcatattccgtttcaaggtt
tggtggactactcattgggtcggatcaaacggacgtgacatcgagaacgagactcaaatc
atcattcttgatcaatccgggtcggattctggacccggatccgggtcgggtcgtccttat
gttctcttgctacctcttcttgaaggctccttccgttcatcattccaatccggagaagac
gatgacgtggcggtctgtgtcgaatccgggtcgaccgaagtaaccgggtcggagtttcgt
cagattgtgtatgtccatgccggggatgacccgttcaagctcgtgaaagacgccatgaaa
gtgattagggttcatatgaatacgttcaagcttcttgaagagaaatcgccgccgggaatt
gtcgataaattcgggtggtgcacttgggatgctttttacttgacggtgaatcctgacgga
gttcataaaggtgttaagtgtctcgtcgacggtggttgtcctccgggattggttcttatc
gacgacggttggcaatcgattggacatgattccgatggtattgatgtcgaagggatgaat
attaccgtcgccggtgaacaaatgccttgcaggcttctgaagtttgaagagaaccacaaa
ttcaaagactacgtttctccaaaagatcaaaacgacgtcggaatgaaagctttcgtcaga
gatctgaaagatgaattctccaccgttgattacatctacgtttggcacgcactttgcggt
tactggggaggtctccgtcctgaagctccggctctgccgccgtcgaccattatccggccc
gagctctctccaggacttaaactaacaatggaagatctcgccgtcgataagatcatagag
accggaatcggatttgcctcgccggacttggcgaaagagttctacgaaggtcttcactct
catcttcaaaacgccggtattgacggcgttaaagttgatgtcatccacatattggagatg
ttatgccagaaatatggcgggagagttgacttggccaaagcttacttcaaggcgttaacg
tcgtcagtgaataagcattttaacggtaacggcgttatcgccagcatggagcattgcaat
gactttatgttccttggaactgaagccatctctcttggtcgtgtcggtgatgacttttgg
tgcacggatccatcaggcgatccaaacggtacgttttggctacaaggatgtcacatggtc
cactgtgcatacaacagtctctggatgggaaatttcattcagcctgattgggacatgttt
cagtccacacatccttgtgctgagttccatgctgcttctcgggccatttccggtgggccg
atttacatcagtgattgtgtgggcaagcatgattttgatctcttgaagcgtcttgttttg
cccaacggttcgattttgaggtgtgagtactatgctctcccaactcgtgaccgtctcttt
gaggatcctcttcatgatggcaaaaccatgctcaagatttggaacttgaacaagtacact
ggagttattggagcattcaactgtcaaggaggaggatggtgcagagaaaccagacgtaac
caatgtttctctgaatgcgtcaacacgttaaccgccaccacaagccctaaagacgttgaa
tggaacagtggaagcagcccaatctccattgcaaacgttgaagagtttgctttgttcttg
tctcaatccaagaagcttttgttgtctggactaaacgatgatcttgagctgactttggag
cctttcaagtttgagctgatcactgtctctcctgttgtgaccattgagggtaattcagtc
cggtttgctccgattggactggttaacatgctaaacacaagcggtgcgatccggtctttg
gtgtataatgatgaatctgttgaggtcggagtttttggtgccggagagtttagggtttat
gcatcgaaaaaacctgtgagctgcttaattgatggtgaagttgttgagtttggttatgaa
gactcaatggtgatggtgcaagtcccttggtctggtccagatggtttgtcttctattcag
tatttgttttag

DBGET integrated database retrieval system