KEGG   Arabidopsis thaliana (thale cress): AT5G55500Help
Entry
AT5G55500         CDS       T00041                                 

Gene name
XYLT
Definition
beta-(1,2)-xylosyltransferase
Orthology
K03714  
glycoprotein 2-beta-D-xylosyltransferase [EC:2.4.2.38]
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 534 aa AA seqDB search
MSKRNPKILKIFLYMLLLNSLFLIIYFVFHSSSFSPEQSQPPHIYHVSVNNQSAIQKPWP
ILPSYLPWTPPQRNLPTGSCEGYFGNGFTKRVDFLKPRIGGGGEGSWFRCFYSETLQSSI
CEGRNLRMVPDRIVMSRGGEKLEEVMGRKEEEELPAFRQGAFEVAEEVSSRLGFKRHRRF
GGGEGGSAVSRRLVNDEMLNEYMQEGGIDRHTMRDLVASIRAVDTNDFVCEEWVEEPTLL
VTRFEYANLFHTVTDWYSAYVSSRVTGLPNRPHVVFVDGHCTTQLEETWTALFSGIRYAK
NFTKPVCFRHAILSPLGYETALFKGLSGEIDCKGDSAHNLWQNPDDKRTARISEFGEMIR
AAFGLPVNRHRSLEKPLSSSSSSASVYNVLFVRREDYLAHPRHGGKVQSRLINEEEVFDS
LHHWVATGSTGLTKCGINLVNGLLAHMSMKDQVRAIQDASVIIGAHGAGLTHIVSATPNT
TIFEIISVEFQRPHFELIAKWKGLEYHAMHLANSRAEPTAVIEKLTEIMKSLGC
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacggaatccgaagattctgaagatttttctgtatatgttacttctcaactct
ctctttctcatcatctacttcgtttttcactcatcgtcgttttcaccggagcagtcacag
cctcctcatatataccacgtttcagtgaataaccaatcggcgattcagaaaccgtggccg
atcttaccttcttacctcccatggacgccgccgcagaggaatctaccaactggctcctgc
gaaggttacttcgggaatggatttacaaagagagttgacttccttaagccgaggattgga
ggaggaggagaaggaagctggttccgatgtttttacagtgagacattacagagttcgatt
tgtgaaggaaggaatctgagaatggttccggatcggattgttatgtcgagaggaggtgag
aagttagaggaagttatggggaggaaagaggaggaggagcttcctgcgtttcgacaaggt
gcgtttgaggtagcggaagaggtttcttcacggttaggttttaagagacaccgtcgtttt
ggtggaggagaaggaggtagtgcggtttctcggcggctggtgaatgatgagatgttgaat
gaatatatgcaagaaggtggaattgatagacatacaatgagagatttggttgcttcgatt
cgtgctgttgataccaatgatttcgtttgtgaagagtgggtggaggaaccgaccttgctt
gtcactagattcgagtacgcaaatctcttccatactgtgacagattggtatagtgcctat
gtttcgtctagagtcaccggtttgcctaatcgacctcacgttgttttcgttgacggacac
tgcacgacgcagctagaagaaacatggacagctttgttttccggaatcagatacgcaaag
aacttcaccaaaccggtttgtttccgccacgcgattctttcaccattgggatacgaaacc
gctctttttaaaggcttgtccggagaaatagactgcaagggagattcagctcacaatctg
tggcaaaacccggacgataaaaggactgcgaggatatcagagtttggtgaaatgatcaga
gcagctttcgggttgcctgtcaatagacaccgctcattagaaaagccgctatcatcatca
tcatcatcagcctcagtttataatgttctttttgtccgccgtgaagattacttagcccat
cctcgtcatggcggtaaagtccagtctcggctcatcaatgaggaagaagtgttcgactcg
ttgcatcattgggttgcaactgggtccaccggtctgaccaaatgcgggattaaccttgtg
aatggcttgcttgcacacatgtcaatgaaagatcaagtccgagccattcaagatgcttca
gtgatcataggagctcatggagcaggactgactcacattgtctctgcaacaccaaacaca
acgatatttgagataataagcgtcgagtttcagagacctcatttcgagcttatagctaag
tggaaaggattggagtatcacgcgatgcatctggcgaactcacgagcggaaccaacggct
gtgattgagaagttaacggagatcatgaagagccttggctgctaa

DBGET integrated database retrieval system