KEGG   Arabidopsis thaliana (thale cress): AT1G01560Help
Entry
AT1G01560         CDS       T00041                                 

Gene name
MPK11
Definition
mitogen-activated protein kinase 11
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AT1G01560 (MPK11)
Protein kinases [BR:ath01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   AT1G01560 (MPK11)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT1G01560 (MPK11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 369 aa AA seqDB search
MSIEKPFFGDDSNRGVSINGGRYVQYNVYGNLFEVSKKYVPPLRPIGRGASGIVCAAWNS
ETGEEVAIKKIGNAFGNIIDAKRTLREIKLLKHMDHDNVIAIIDIIRPPQPDNFNDVHIV
YELMDTDLHHIIRSNQPLTDDHSRFFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDL
KIGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTREPL
FPGRDYVQQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAARFPNMSVNAV
DLLQKMLVFDPNRRITVDEALCHPYLAPLHEYNEEPVCVRPFHFDFEQPSLTEENIKELI
YRESVKFNP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatagagaaaccattcttcggtgatgacagcaacagaggagtaagtatcaatggt
ggtcgttatgtgcagtataatgtctatggaaatctctttgaagtttctaaaaagtatgtt
cctcctcttcgtcctatcggcagaggcgcttctggcatcgtctgtgctgcatggaattcg
gagacgggtgaggaagtagcgatcaagaagattggtaatgcatttggcaacattatcgac
gctaagagaactttgagagagattaagcttcttaagcatatggatcatgacaatgtcatt
gccattatagacataataagaccacctcagccagacaacttcaatgatgttcacattgtc
tatgagttaatggacactgatcttcaccacattatccgctctaaccaaccgttaactgat
gatcattcacggttcttcctgtatcagttgttgcgaggcctcaagtatgtgcattcagcc
aatgtactgcatcgtgatttaaaaccgagtaacttgctcctgaatgcaaactgtgacctc
aagattggggattttgggcttgcgaggactaaatcagagacagacttcatgacagaatat
gttgttacacgttggtaccgagctccagagttgctccttaattgctcagaatacactgca
gctatcgacatttggtctgtcggttgtatactcggtgaaataatgacgcgggagccgtta
tttccgggcagagattatgttcagcagcttagactcatcactgagcttataggctcacca
gatgattcaagcctaggattcttaagaagcgacaacgctagaagatacgtaagacagctt
ccacagtatccaagacaaaactttgccgctagattcccaaacatgtcggtcaatgctgtt
gatttgctgcagaaaatgctcgtctttgacccaaacagacgcattacagtcgatgaagcc
ttgtgccacccttacttagcaccgctacacgaatataacgaggaacctgtgtgtgtgaga
ccgttccattttgatttcgagcaaccttcattgacggaagagaacatcaaggagcttata
tatcgtgaatcagtcaagtttaacccttaa

DBGET integrated database retrieval system