KEGG   Arabidopsis thaliana (thale cress): AT1G02530Help
Entry
AT1G02530         CDS       T00041                                 

Gene name
PGP12
Definition
(RefSeq) P-glycoprotein 12
  KO
K05658  
ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:3.6.3.44]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    AT1G02530 (PGP12)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.44  xenobiotic-transporting ATPase
     AT1G02530 (PGP12)
Transporters [BR:ath02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5, 11 subgroups
    AT1G02530 (PGP12)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT1G02530 (PGP12)
Cellular antigens [BR:ath04090]
 Proteins
  AT1G02530 (PGP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 1273 aa AA seqDB search
MNRDGAGEGDSVSHEHSTSKTDEKAKTVPLYKLFAFADSFDVFLMICGSLGAIGNGVCLP
LMTLLFGDLIDSFGKNQNNKDIVDVVSKVCLKFVYLGLGRLGAAFLQVACWMITGERQAA
KIRSNYLKTILRQDIGFFDVETNTGEVVGRMSGDTVHIQDAMGEKVGKFIQLVSTFVGGF
ALAFAKGWLLTLVMLTSIPFLAMAGAAMALLVTRASSRGQAAYAKAATVVEQTIGSIRTV
ASFTGEKQAINSYKKYITSAYKSSIQQGFSTGLGLGVMIYVFFSSYALAIWFGGKMILEK
GYTGGSVINVIIIVVAGSMSLGQTSPCVTAFAAGQAAAYKMFETIKRKPLIDAYDVNGKV
LGDIRGDIELKDVHFSYPARPDEEIFDGFSLFIPSGATAALVGESGSGKSTVINLIERFY
DPKAGEVLIDGINLKEFQLKWIRSKIGLVCQEPVLFSSSIMENIAYGKENATLQEIKVAT
ELANAAKFINNLPQGLDTKVGEHGTQLSGGQKQRIAIARAILKDPRVLLLDEATSALDTE
SERVVQEALDRVMVNRTTVVVAHRLSTVRNADMIAVIHSGKMVEKGSHSELLKDSVGAYS
QLIRCQEINKGHDAKPSDMASGSSFRNSNLNISREGSVISGGTSSFGNSSRHHSLNVLGL
FAGLDLGSGSQRVGQEETGTTSQEPLRKVSLTRIAALNKPEIPVLLLGTVVAAINGAIFP
LFGILISRVIEAFFKPADQLKKDSRFWAIIFVALGVTSLIVSPSQMYLFAVAGGKLIRRI
QSMCFEKAVHMEVSWFDEPENSSGTMGARLSTDAALIRALVGDALSLAVQNAASAASGLI
IAFTASWELALIILVMLPLIGINGFLQVKFMKGFSADAKSKYEEASQVANDAVGSIRTVA
SFCAEEKVMQMYNKQCEGPIKDGVKQGFISGLGFGFSFFILFCVYATSFYAAARLVEDGK
TTFIDVFQVFFALTMAAIGISQSSTFAPDSSKAKVAAASIFAIIDRKSKIDSSDETGTVL
ENVKGDIELRHLSFTYPARPGIQIFRDLCLTIRAGKTVALVGESGSGKSTVISLLQRFYD
PDSGQITLDGVELKKLQLKWLRQQMGLVGQEPVLFNDTIRANIAYGKGSEEAATESEIIA
AAELANAHKFISSIQQGYDTVVGEKGIQLSGGQKQRVAIARAIVKEPKILLLDEATSALD
AESERLVQDALDRVIVNRTTVVVAHRLSTIKNADVIAIVKNGVIAENGTHETLIKIDGGV
YASLVQLHMTASN
NT seq 3822 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtgacggcgccggagaaggcgactctgtttcacacgaacattcaacatctaaa
accgatgaaaaggccaagacagttcctctctacaagctatttgcgtttgcagattccttc
gatgtgtttttgatgatatgtggctcacttggagctattgggaatggagtgtgtttacct
cttatgacattgttgtttggtgatctcatcgattcctttggaaaaaatcagaacaacaaa
gacattgttgatgttgtctcaaaggtttgtcttaaattcgtctaccttggacttggaaga
cttggagcagcctttcttcaggttgcttgttggatgattactggagagagacaagccgca
aagataagaagtaactatctgaaaacaattctgagacaagacatcggattcttcgatgtt
gaaacaaacacaggagaggttgttggtagaatgtctggagatactgttcatattcaagat
gccatgggtgagaaggtggggaagtttattcagctggtatctactttcgttggcggattt
gctttagcttttgctaaaggatggttgctaacattggttatgttaacttcgattcctttt
ctggctatggctggtgcagccatggcgcttttagtgactcgagcttcttctcggggacaa
gccgcttatgcaaaagcagcaactgttgttgaacagacaatcgggtctatccgaacggtt
gcttcttttacgggagagaagcaagcaataaacagctacaagaagtacataacatcggct
tataaatcaagcattcaacaaggtttctccactggtttaggacttggagtaatgatctat
gtgttcttcagcagctatgctttggctatttggtttggtgggaagatgatactcgaaaaa
gggtataccggtggctctgtgatcaacgtgatcatcattgtggttgcgggttcaatgtcg
cttgggcaaacatctccatgtgtaaccgcatttgcagcaggtcaagctgcagcatataag
atgtttgagacgatcaaaagaaagcctttgattgatgcttatgacgtaaatggaaaggtt
cttggagatatccgaggagacattgaactgaaagatgtgcatttcagttaccccgcgagg
ccagacgaggagatatttgatggattctctctgtttatcccgagcggtgcaacagcagca
ctggtaggagaaagtggaagtggaaaatctacggtgataaatttgattgagaggttttat
gatccgaaagccggtgaagtactcattgatggaattaatcttaaggagtttcagttgaaa
tggatcagaagcaaaatcggattggtctgccaagaacctgttctgttttcgtcgagcatc
atggagaatatcgcctacgggaaagaaaatgcaacgcttcaagagattaaagtagcaaca
gagctagcaaatgcagcaaagttcataaataacttacctcaggggttagatacaaaggta
ggagagcacgggacacagctctcgggaggacagaaacagaggatagctattgcaagagct
attcttaaagatccgcgggttttgcttctggatgaagcaacaagcgcgctcgatacagaa
tccgaaagagtggttcaagaggctttagatagagtcatggttaaccggactacggtggtg
gttgcgcatagattaagcacggtaagaaatgcggatatgattgcagtaattcacagcgga
aaaatggtggaaaaaggttcgcattctgagttgttgaaagattccgtgggagcttattcg
cagctcattcggtgtcaagagataaacaagggtcatgatgcaaaaccatcagacatggct
tcgggatcatctttccggaattcgaatttgaacatatcaagagagggatcggttatcagt
ggtggaacctcgtcttttggaaatagcagtcgtcatcattctttgaatgtccttggttta
ttcgctggactagaccttggtagcggtagccaaagagtaggccaagaggaaactggaacg
acgagtcaagaaccgctccgaaaagtatcactcacccgaatcgcagctctaaacaaacct
gagatcccggttctccttcttggaactgtagtagcagcaatcaatggcgcgattttcccg
cttttcgggattctgatttcaagagtcatcgaagcgttcttcaaaccagctgaccaatta
aagaaagattcaagattctgggcgattatatttgtagctctgggagtaacttcgttgatt
gtctcaccgtctcaaatgtatctgtttgcagtagctggaggaaaacttatacgacgaatt
cagtcaatgtgctttgagaaagcggttcacatggaggttagctggttcgatgagccagag
aactcgagtggtacaatgggggcaaggctctcgactgatgcagctttgattagagctcta
gtaggagatgcattgtctttagcggttcaaaacgctgcatctgctgcgtctggattgatt
atagcgttcactgcgagttgggaattggcgcttataatcttagtgatgcttcctcttatt
ggtatcaatggctttcttcaagtcaagtttatgaaaggattcagcgccgacgcaaagtca
aagtatgaggaggcaagtcaggtagcgaacgacgcggtggggagtataagaacagttgca
tctttctgcgcggaggagaaagtgatgcagatgtataataagcaatgtgaaggtccgata
aaagatggagtaaagcaaggtttcatcagcggattagggtttggattctccttcttcatt
ctgttttgtgtctacgcgacaagcttctacgcggcagctagattggttgaagatggcaaa
actactttcattgatgttttccaggtgtttttcgcgttaaccatggcagctattggaatt
tctcagtcgagtactttcgctccagattcaagcaaagccaaggtcgcagctgcttcaatc
ttcgcgatcatcgatagaaaatcaaagatagactcgagcgatgagacagggacagtgttg
gagaacgttaagggagatattgagcttcgtcacttaagcttcacttatccagcaagacca
ggcattcagatctttcgtgatctttgcttaaccattcgcgcaggaaagacggttgctttg
gtcggcgaaagtgggtcggggaaatcgacggtgatctcgctgttacaaagattttacgat
ccagattccggtcagataactttagacggagttgagctcaagaagctgcaattgaaatgg
ttgagacaacaaatgggactagtgggacaagaacctgtcttgttcaacgacacgattcga
gccaacattgcttatggcaaaggaagtgaagaggccgcaaccgagtctgaaatcatagcc
gctgcagaacttgccaatgcacacaaattcatctctagcatacaacagggttacgacaca
gtggtgggagagaaagggattcagttatcaggaggacagaaacagcgggtagctatagca
cgtgccatcgtgaaagagccgaagatattgcttttggacgaagcaacgagtgctcttgat
gcagaatcagagcgactggttcaggatgcgcttgaccgagtgattgtaaaccgaaccacg
gttgtggtggctcaccggttatcgaccattaaaaacgctgacgtcattgccatcgttaag
aacggtgtgatcgctgagaatgggactcacgaaacgttgatcaaaatagacggtggggtt
tatgcttcccttgttcagcttcacatgactgcttctaattga

DBGET integrated database retrieval system