KEGG   Arabidopsis thaliana (thale cress): AT1G03457Help
Entry
AT1G03457         CDS       T00041                                 

Definition
(RefSeq) RNA recognition motif-containing protein
  KO
K13207  
CUG-BP- and ETR3-like factor
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Spliceosome [BR:ath03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    AT1G03457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 429 aa AA seqDB search
MAEETMENEERVKLFVGQVPKHMTEIQLLTLFREFSIVNEVNIIKEKTTRAPRGCCFLTC
PTREDADKVINSFHNKKTLPGASSPLQVKYADGELERLEHKLFVGMLPKNVSETEVQSLF
SEYGTIKDLQILRGSLQTSKGCLFLKYESKEQAVAAMEALNGRHIMEGANVPLIVKWADT
EKERQARRLLKVQSHVSRLDPQNPSMFGALPMSYVPPYNGYGYHVPGTYGYMLPPIQTQH
AFHNVISPNQGNGRALQGTALTESVPPRLAPRRNFPTALGNYGYHGLQYPMAFPRGMIPP
RLPLTTVSPGISNNGTSIPSSLQTEGPAGANLFIYNIPREFEDQELAATFQPFGKVLSAK
VFVDKATGISKCFGFISYDSQAAAQNAINTMNGCQLSGKKLKVQLKRDNGQQQQQQQSKN
PLFNGLLNS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggagacgatggagaacgaagagagggtgaagctgttcgtcggacaagttccg
aagcacatgacggagattcagctcctcacattgtttcgagaattctccatcgtcaatgaa
gtcaacatcattaaagagaagacaacacgagctcctcgaggatgttgttttctgacatgt
cctacaagggaagatgctgacaaggtgatcaatagttttcataacaagaagacattgcct
ggggcatctagtccgttgcaagttaagtatgcagatggcgagttggaaagactagagcac
aaacttttcgtcggtatgcttccaaagaatgtctctgaaactgaagtccagtccttattc
tctgaatacggaaccattaaggatctacagattctaagagggtctctacaaactagcaaa
ggctgtctgtttctaaagtacgagtctaaagaacaagcggtcgcagctatggaagccctc
aacggaagacatataatggagggagcaaatgttcctttgattgttaaatgggcagacaca
gaaaaggaaagacaagctcgaagacttctaaaagttcaatctcatgtctccagactcgat
ccgcaaaacccctccatgtttggagcattacctatgagttatgttcctccttacaatgga
tatggctatcatgtgcctggaacttatggctacatgctaccacctatccagactcaacat
gcatttcacaatgtgatttcacctaaccaaggtaacggcagggcattgcagggaaccgct
ttgacagagtctgtcccaccacgtttggccccccgcagaaacttcccaacggctcttgga
aattacggttaccatggtcttcaatatcctatggcatttcctagagggatgatacctcct
cgccttcctctaaccacagtttcacctggaatttctaataacggcacatcgataccttcc
tcgcttcaaacagaaggaccagcaggtgcgaatctatttatttataacatacctcgggaa
ttcgaggatcaagaactcgcggctacgtttcaaccttttggtaaggttctaagcgccaag
gtgtttgtagacaaggccactggtataagcaaatgtttcggattcattagttatgactca
caggcagctgctcagaacgctattaacacaatgaacggttgccaattaagcggtaagaaa
ttgaaagtccagcttaagagagacaacggtcaacagcagcaacaacaacagagtaaaaac
ccgttatttaacggtttattaaactcgtaa

DBGET integrated database retrieval system