KEGG   Arabidopsis thaliana (thale cress): AT1G04400Help
Entry
AT1G04400         CDS       T00041                                 

Gene name
CRY2
Definition
(RefSeq) cryptochrome 2
  KO
K12119  
cryptochrome 2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    AT1G04400 (CRY2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 612 aa AA seqDB search
MKMDKKTIVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSL
AHLSQSLKALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLV
ERGISVQSYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSIESVMLPPPWRLMPITAA
AEAIWACSIEELGLENEAEKPSNALLTRAWSPGWSNADKLLNEFIEKQLIDYAKNSKKVV
GNSTSLLSPYLHFGEISVRHVFQCARMKQIIWARDKNSEGEESADLFLRGIGLREYSRYI
CFNFPFTHEQSLLSHLRFFPWDADVDKFKAWRQGRTGYPLVDAGMRELWATGWMHNRIRV
IVSSFAVKFLLLPWKWGMKYFWDTLLDADLECDILGWQYISGSIPDGHELDRLDNPALQG
AKYDPEGEYIRQWLPELARLPTEWIHHPWDAPLTVLKASGVELGTNYAKPIVDIDTAREL
LAKAISRTREAQIMIGAAPDEIVADSFEALGANTIKEPGLCPSVSSNDQQVPSAVRYNGS
KRVKPEEEEERDMKKSRGFDERELFSTAESSSSSSVFFVSQSCSLASEGKNLEGIQDSSD
QITTSLGKNGCK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggacaaaaagactatagtttggtttagaagagacctaaggattgaggataat
cctgcattagcagcagctgctcacgaaggatctgtttttcctgtcttcatttggtgtcct
gaagaagaaggacagttttatcctggaagagcttcaagatggtggatgaaacaatcactt
gctcacttatctcaatccttgaaggctcttggatctgacctcactttaatcaaaacccac
aacacgatttcagcgatcttggattgtatccgcgttaccggtgctacaaaagtcgtcttt
aaccacctctatgatcctgtttcgttagttcgggaccataccgtaaaggagaagctggtg
gaacgtgggatctctgtgcaaagctacaatggagatctattgtatgaaccgtgggagata
tactgcgaaaagggcaaaccttttacgagtttcaattcttactggaagaaatgcttagat
atgtcgattgaatccgttatgcttcctcctccttggcggttgatgccaataactgcagcg
gctgaagcgatttgggcgtgttcgattgaagaactagggctggagaatgaggccgagaaa
ccgagcaatgcgttgttaactagagcttggtctccaggatggagcaatgctgataagtta
ctaaatgagttcatcgagaagcagttgatagattatgcaaagaacagcaagaaagttgtt
gggaattctacttcactactttctccgtatctccatttcggggaaataagcgtcagacac
gttttccagtgtgcccggatgaaacaaattatatgggcaagagataagaacagtgaagga
gaagaaagtgcagatctttttcttaggggaatcggtttaagagagtattctcggtatata
tgtttcaacttcccgtttactcacgagcaatcgttgttgagtcatcttcggtttttccct
tgggatgctgatgttgataagttcaaggcctggagacaaggcaggaccggttatccgttg
gtggatgccggaatgagagagctttgggctaccggatggatgcataacagaataagagtg
attgtttcaagctttgctgtgaagtttcttctccttccatggaaatggggaatgaagtat
ttctgggatacacttttggatgctgatttggaatgtgacatccttggctggcagtatatc
tctgggagtatccccgatggccacgagcttgatcgcttggacaatcccgcgttacaaggc
gccaaatatgacccagaaggtgagtacataaggcaatggcttcccgagcttgcgagattg
ccaactgaatggatccatcatccatgggacgctcctttaaccgtactcaaagcttctggt
gtggaactcggaacaaactatgcgaaacccattgtagacatcgacacagctcgtgagcta
ctagctaaagctatttcaagaacccgtgaagcacagatcatgatcggagcagcacctgat
gagattgtagcagatagcttcgaggccttaggggctaataccattaaagaacctggtctt
tgcccatctgtgtcttctaatgaccaacaagtaccttcggctgttcgttacaacgggtca
aagagagtgaaacctgaggaagaagaagagagagacatgaagaaatctaggggattcgat
gaaagggagttgttttcgactgctgaatcttcttcttcttcgagtgtgtttttcgtttcg
cagtcttgctcgttggcatcagaagggaagaatctggaaggtattcaagattcatctgat
cagattactacaagtttgggaaaaaatggttgcaaatga

DBGET integrated database retrieval system