KEGG   Arabidopsis thaliana (thale cress): AT1G04410Help
Entry
AT1G04410         CDS       T00041                                 

Definition
(RefSeq) malate dehydrogenase
  KO
K00025  
malate dehydrogenase [EC:1.1.1.37]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT1G04410
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AT1G04410
   00620 Pyruvate metabolism
    AT1G04410
   00630 Glyoxylate and dicarboxylate metabolism
    AT1G04410
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT1G04410
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AT1G04410
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     AT1G04410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 332 aa AA seqDB search
MAKEPVRVLVTGAAGQIGYALVPMIARGIMLGADQPVILHMLDIPPAAEALNGVKMELID
AAFPLLKGVVATTDAVEGCTGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQAAALEKH
AAPNCKVLVVANPANTNALILKEFAPSIPEKNISCLTRLDHNRALGQISERLSVPVSDVK
NVIIWGNHSSSQYPDVNHAKVQTSSGEKPVRELVKDDAWLDGEFISTVQQRGAAIIKARK
LSSALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYSVPSGLIYSFPVTCRNGDWSIV
QGLPIDEVSRKKMDLTAEELKEEKDLAYSCLS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagaaccagttcgtgtgctcgttactggagctgcaggacaaatcggatatgct
cttgtacctatgattgcaaggggtatcatgcttggtgctgaccaacctgttatcctccac
atgttggatattcctccagctgctgaagctttgaacggtgttaagatggagttgatcgat
gctgctttccctcttcttaaaggtgttgttgctacaactgatgccgttgagggatgtact
ggagtcaatgttgctgttatggttggtggtttcccgaggaaagaaggtatggagaggaag
gatgtgatgtccaagaatgtttccatctacaagtctcaggctgctgccttggagaagcat
gccgctcctaactgcaaggttcttgttgtggccaacccggcaaacaccaacgcattgatc
ctcaaggaatttgcaccatcaatccctgaaaagaacatctcttgtttgacaaggcttgac
cacaacagggctttgggacagatctctgagaggttgagcgtgccagtgtctgatgttaag
aacgtgatcatctggggaaaccactcatcctcacagtacccagatgtcaaccatgctaaa
gtgcagacctcgtctggagagaagcctgtccgtgagctcgtcaaggacgatgcatggttg
gacggagaatttatctctacagttcaacaacgtggagctgcaatcatcaaggcgaggaag
ttgtctagtgcgctctctgctgctagctctgcttgtgaccacatccgtgactgggtcctt
ggaactccagagggtacgttcgtttccatgggagtatactccgatggctcttacagcgtt
ccatcaggacttatctactccttccctgtaacttgtcgcaatggagactggagtattgtc
caaggccttccgattgatgaagtatcaaggaagaagatggatttgactgcagaggagctc
aaggaagagaaggacttggcgtactcatgcctctcttaa

DBGET integrated database retrieval system