KEGG   Arabidopsis thaliana (thale cress): AT1G04860Help
Entry
AT1G04860         CDS       T00041                                 

Gene name
UBP2
Definition
ubiquitin-specific protease 2
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AT1G04860 (UBP2)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AT1G04860 (UBP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 961 aa AA seqDB search
MGKKAKKKARAPTKEIQTMEISKKVSEEPPSQAGEIAEGDVKAVKETQACVHFDKALNLE
KVLDKIKSSRQIKCAECNEGVYGKRGTKAKGSKGKKDFSSSDPKSNNKAIWLCLECGCYV
CGGVGLPNGPQSHVLRHSRVTRHRLVIQWENPQLRWCFPCQLLLPVEKEDNGEKKDVLSE
VVKLIKGRSLNNLASSDIEDQCSGSGSITSDIKLEGAVTSDIEARDGYVVRGLVNLGNTC
FFNSIMQNLLSLDRLRDHFLKENGSGVGGPLASSLRKLFTETKPEAGLKSVINPRAFFGS
FCSKAPQFRGYDQHDSHELLRCLLDSLSTEESALRKKRGVSDNDEKSTTLIESVFGGETS
SIVSCMECGHSSKVYEPFLDLSLPVPFKKSPPKKPQPVSRAKKAKLPPKRVPKNVSKVSK
VSKVLPGMVLSELNSSGKSMAVTADSDTSCSSLAPLDNGPVLETPSVLTLDNNQASESAS
QSDTGFDGSWLDFIGPETSGDETNLDMQEDGIDNVITAEVNQIVPSPNIVANSSVSSGDQ
TLEGNTERLMQDYEEIAKAEANLDEKDVQAMQSDECPATSGISAEFSQASCIGCDPGIGE
SSSSVNPWDEEELPLVVADSQILYMPYKEISCNDKSVEGECEASSSFVTGDHEPQNSDFV
DFGGLFDEPETTEGPVFGPPSKAEASGVGFMAFSSESDPEEIDDSDLPVSVERCLGHFTK
HEILSDDNAWNCENCSKNLKLQRLREKRKSNEDESRSSNTSNGWVKENEDEGFGETEILA
VKQDPNDTSCVKDHSSDGRKAARIHSADESESKGTQDEDEDSEKVITVKRDATKKVLINK
APPVLTIHLKRFSQDLRGRLSKLNGHVAFKEVIDLRQYMDSRCSGEDPPVYRLAGLVEHS
GTMRGGHYVAYVRGGQRVKETDSSSTAWYNVSDAYVRQVSLEKVLHSEAYILFYERIFSQ
E
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaagcgaagaagaaggcccgagctccaacaaaggagattcagaccatggaa
atttccaagaaggtctcagaagagccgcctagtcaagccggggaaattgctgagggtgac
gttaaagcagttaaggagacacaagcttgtgtgcatttcgataaggctcttaatttggag
aaggtgttggataagattaagtcatcccggcagattaagtgtgcagaatgcaatgaagga
gtgtatggaaagagaggaactaaagcaaagggcagtaaagggaagaaggatttttcttct
tctgatccaaaatctaataacaaagccatttggctatgtttggaatgtggctgttatgtt
tgtggaggtgttggtttaccaaatggacctcagagccatgttttgcgacacagcagagtg
acacgtcaccgattggtgattcaatgggaaaatcctcagttaagatggtgtttcccgtgc
cagttgcttctccctgttgaaaaagaagataatggcgagaagaaagatgtactgtcagag
gttgttaaattgattaaaggacgatctttgaacaatttagcttcatccgatatcgaagat
cagtgctcaggaagtggcagtatcactagtgatatcaaactagaaggtgctgtgaccagt
gatatagaagcaagagatggttatgttgtgcgaggtttagttaaccttgggaacacatgt
ttctttaattcgataatgcagaatcttctttctttggatcggttacgcgatcacttcttg
aaagagaatgggtctggggtcggtgggcctcttgcgtcttccctgaggaaattattcact
gaaacgaaaccagaggcaggcttgaagagtgtgataaatcctagagccttttttgggtct
ttctgttctaaggcaccccagttccggggatatgaccagcatgatagccacgagttgcta
cgctgtttgctagattcgttgagcaccgaagaatcggccttgagaaagaagcgtggtgtt
tctgataatgatgagaaatctactactctcatagaatctgtatttggaggcgaaacgtcg
agcattgttagttgtatggagtgcgggcattcctcaaaagtctatgaaccatttttggat
ctctccttacccgtaccattcaagaaaagccctcctaaaaaaccacaacctgtttctcga
gcaaaaaaagctaagcttccacctaagagagtcccaaagaatgtgtcaaaagtaagtaag
gtttcaaaagttctcccaggtatggttctttcggaactgaactcttccggaaaatctatg
gctgtcacagctgattcggatacatcctgttccagtttagcaccccttgataatggtccg
gttttagaaactccttcagttctaacccttgacaataatcaggcctcagaaagtgcatca
caaagtgatactggtttcgatggctcctggttggattttatcggaccagaaacctctgga
gatgagacgaatttggatatgcaagaagatggtattgataatgtcattacagctgaggtt
aatcaaattgttcccagtccaaatattgtggcgaatagctcagtttcatcgggtgatcag
actttggaaggtaatacagagaggctgatgcaagattatgaagaaattgcaaaggcggaa
gccaatttggatgaaaaagatgtacaagctatgcagtctgatgaatgcccagctacaagt
ggtatttctgctgaattcagtcaagctagttgcattggttgtgatcctggtataggggaa
agttcttcctcggtgaatccttgggacgaggaagagcttcctttggtggttgcagattcg
caaattttgtacatgccatacaaagaaatatcctgtaatgataaatcagttgaaggtgag
tgtgaagcttcatcttcatttgttactggtgatcatgaaccacaaaacagtgattttgtt
gattttggcggtttatttgatgagcctgagactactgagggacctgtttttggacctcct
tccaaggctgaagcctcgggagttggttttatggcgttcagcagcgagtctgatcctgaa
gaaatcgatgattcggatttaccggtgtctgtagagaggtgtttgggtcatttcacaaaa
catgagatactgtcagatgacaatgcttggaactgcgagaactgttcaaagaacctgaaa
ctccaacggttgagagaaaagcgaaaatccaatgaagatgaatcgagatcaagcaacacc
agcaacggatgggtgaaagaaaatgaagatgaaggttttggagaaaccgaaattttggct
gttaaacaagatccaaatgatactagttgtgtcaaggatcatagctctgatggaagaaaa
gctgcgaggattcactcagctgatgaaagtgaatccaaaggaactcaagatgaagacgaa
gattctgagaaggtgattacagtgaagagagatgcaactaaaaaagtacttataaacaaa
gccccacctgtcctaaccattcatctaaaacgattcagccaagatttgcgtggtaggcta
agtaaattaaatggtcatgttgctttcaaagaggtcatcgatcttcgacaatatatggac
tcaaggtgtagcggagaagacccgcccgtttacagactggctggattggtggagcattca
gggacgatgagaggaggtcattatgtggcgtatgttagaggaggtcagcgggttaaagag
actgattcctcctccactgcgtggtataacgtaagcgatgcatatgttcgtcaggtttca
ttggaaaaggttctgcattctgaagcgtatatcttgttctatgaacggatcttctcacaa
gaatga

DBGET integrated database retrieval system