KEGG   Arabidopsis thaliana (thale cress): AT1G05000Help
Entry
AT1G05000         CDS       T00041                                 

Gene name
PFA-DSP1
Definition
(RefSeq) Phosphotyrosine protein phosphatases superfamily protein
  KO
K18045  tyrosine-protein phosphatase SIW14 [EC:3.1.3.48]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     AT1G05000 (PFA-DSP1)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Atypical DSPs
    AT1G05000 (PFA-DSP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase2 Y_phosphatase3 DSPc Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 839348
NCBI-ProteinID: NP_171993
MIPS: AT1G05000.1
TAIR: AT1G05000
Araport: AT1G05000
UniProt: Q9ZVN4
Structure
PDB: 

Jmol
Position
1
AA seq 215 aa AA seqDB search
MKLVEKTTTTEQDNGEDFCRTIIEVSEVNRNVFQAPGGEADPFRVVSGEELHLIPPLNFS
MVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLFQFGIEGNK
EPFVNIPDHKIRMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLTSIFDEYQ
RFAAAKARVSDQRFMEIFDVSSFSHIPMSFSCSIR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgtggagaagacgactactacagagcaggacaatggagaagatttctgccgc
accatcatcgaggtttccgaggttaacagaaacgtgtttcaggctccgggcggtgaagct
gatccctttcgagttgtctccggcgaagaacttcacctaattccgccgctcaacttctcc
atggtcgataacggtatattccggtctggattccctgattcagctaacttctcctttctc
cagactctcggtctccgctcaatcatatacttgtgcccggagccctacccagagagcaat
ctccagttccttaaatccaatggaatcaggcttttccagtttggtattgaaggcaacaag
gagccatttgtgaatattccagaccataaaatccgcatggcactgaaagtgcttctagat
gagaaaaaccatcctgttctgattcattgtaagcgaggcaagcatcggaccggttgtctt
gttggttgcttgaggaagctccagaaatggtgtttgacatcgatattcgacgagtaccaa
cgatttgcagcagcgaaagctagagtttcagatcaaagattcatggagatattcgatgtt
tccagcttcagtcatattccaatgtcattctcttgttccatcaggtaa

DBGET integrated database retrieval system