KEGG   Arabidopsis thaliana (thale cress): AT1G05030Help
Entry
AT1G05030         CDS       T00041                                 

Definition
(RefSeq) putative plastidic glucose transporter 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 524 aa AA seqDB search
MWVTNTVLLYRPNSMNRLTFSYPTRLAHSRKASSFSRFFRSSKRKKRVTTLSTKKPDDDH
EISPVPPEKFSADLGWLSAFPHVSVASMANFLFGYHIGVMNGPIVSIARELGFEGNSILE
GLVVSIFIAGAFIGSIVAGPLVDKFGYRRTFQIFTIPLILGALVSAQAHSLDEILCGRFL
VGLGIGVNTVLVPIYISEVAPTKYRGSLGTLCQIGTCLGIIFSLLLGIPAEDDPHWWRTM
LYVASMPGFLLALGMQFAVESPRWLCKVGRLDDAKVVIRNIWGGSEVEKAVEDFQSVMKN
SGSNLNSRWLELLDKPHSRVAFIGGSLFVLQQFAGINGVLYFSSLTFQNVGITSGAQASL
YVGVTNFAGALCASYLIDKQGRKKLLIGSYLGMAVSMFLIVYAVGFPLDEDLSQSLSILG
TLMYIFSFAIGAGPVTGLIIPELSSNRTRGKIMGFSFSVHWVSNFLVGLFFLDLVEKYGV
GTVYASFGSVSLLAAAFSHLFTVETKGRSLEEIELSLNSRDDLS
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtgacgaataccgtacttctatatcgacccaattctatgaaccgattaaccttt
tcttacccgacccgactcgcccactctcgtaaagcctcttccttttcccgtttctttcgg
tcttcaaagaggaagaagcgggttacgacattgtcgacgaagaaaccagatgacgatcac
gagatatcgccagttccgccggagaaattctccgctgatttgggatggttatcggctttt
cctcatgtatcagttgcttctatggccaattttctctttggttatcacattggagtgatg
aatggccccatcgtgtctattgcgcgtgaacttgggtttgaaggcaattctattcttgag
ggtcttgttgtgagcatatttattgccggtgcatttattggtagcatagtcgccggtcca
ctagttgacaagtttggctaccgacgcacctttcagattttcacgatacccctcattctt
ggtgcccttgtgagtgcacaagctcactccttggatgagatcttatgtggaagatttctt
gttggtcttggtattggcgtcaacacagttcttgttccaatatatatatccgaggttgct
ccgacgaaatacagaggttcccttggaactttatgtcaaattggcacttgtctcgggata
atcttttctcttctcttagggattcctgcagaagatgaccctcattggtggaggacaatg
ctctatgtagcgagtatgcctggttttcttcttgcacttggtatgcaatttgcagtagaa
agtccccgttggctctgtaaggttggacgacttgatgatgccaaagtagtgataagaaac
atctggggaggatctgaagtcgagaaagctgtagaagattttcagtcggttatgaagaat
agtggctccaacttaaatagcagatggctggaactccttgataaaccacattcacgagtt
gcattcattgggggctccctttttgtcctacagcaattcgcgggcataaatggcgttctt
tatttctcatctttaacattccaaaatgttggaatcacgagtggtgctcaagcaagtcta
tatgttggagtcacaaattttgcaggtgctctgtgtgcgtcttatttgattgataagcaa
ggaagaaagaagcttcttatcggtagctacttgggaatggcagtctctatgtttcttatt
gtttatgctgttggtttccccttggatgaagatctgagccagagtttgtcaatacttgga
acactcatgtatatattcagttttgcaattggagctggtcctgtaacaggtctcatcatc
cctgagctaagcagcaacagaacgcgtggaaaaatcatgggtttcagcttctctgtacat
tgggtctccaacttcttggttggtttgttcttcctggatctggtggagaaatacggggtt
ggaacggtctatgccagctttggctcagtatcattgttggcagcggcattctcacacctc
ttcacggtggaaacaaagggtcgatcactagaagagatcgaactgtctttgaactccaga
gacgacctgagttaa

DBGET integrated database retrieval system