KEGG   Arabidopsis thaliana (thale cress): AT1G05420Help
Entry
AT1G05420         CDS       T00041                                 

Gene name
OFP12
Definition
(RefSeq) ovate family protein 12
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Ovate
Motif
Other DBs
NCBI-GeneID: 837043
NCBI-ProteinID: NP_172033
MIPS: AT1G05420.1
TAIR: AT1G05420
Araport: AT1G05420
UniProt: F4I8R6 A0A178WNG4
Position
1
AA seq 226 aa AA seqDB search
MPRVMWKNFHLCFPSNLTKPSSSPSGATSDDPNRPSILLINNFNLLYDDSSAAHRRLSKP
LIHDVEPSSTFTASTSTAANSSSSSASYDDSDNYGFAPDDDSPPPDLTAVLASRRFFFSS
PGCSNSITDSPDLRCRDNYDTATRLLTGGTAVKHYVQSPDPYNDFRRSMQEMIDAVTNAG
DLRRYEFLHELLLSYLSLNAADTHKFIIRAFADILVSLLSDGHRIS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgccaagagtcatgtggaaaaacttccatctttgcttcccatcaaatctcaccaagccc
tcttcatctccgtccggtgccacctccgacgatcccaaccgtccatccattcttctcatc
aacaactttaacctcctatatgacgactcctccgccgcccaccgccgcctatccaagcct
cttatccacgacgttgaaccctcttccaccttcaccgcctccacctccaccgcagctaac
tcttcttcctcctctgcctcttatgatgattccgataattacggttttgcccctgacgac
gactctccccctcctgacttaaccgccgttttagcctcccgccgcttcttcttctcttct
cctggctgctcaaactcaatcactgactcgccagatctccgctgccgggataattacgat
actgccactaggcttcttaccggaggaaccgccgtgaaacactacgtgcaatctcctgat
ccgtacaacgacttccgacgatcaatgcaggagatgatcgacgccgttacaaacgccgga
gatcttcgccgttacgagttcttgcatgagctgttactcagttacctctctttaaatgcc
gccgatacacacaagttcattatcagagctttcgccgacattctcgtctctctcctatcg
gacggtcaccggatcagctga

DBGET integrated database retrieval system