KEGG   Arabidopsis thaliana (thale cress): AT1G06080Help
Entry
AT1G06080         CDS       T00041                                 

Gene name
ADS1
Definition
delta-9 acyl-lipid desaturase 1
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ath01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ath01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 305 aa AA seqDB search
MSLSASEKEENNKKMAADKAEMGRKKRAMWERKWKRLDIVKAFASLFVHFLCLLAPFNFT
WPALRVALIVYTVGGLGITVSYHRNLAHRSFKVPKWLEYFFAYCGLLAIQGDPIDWVSTH
RYHHQFTDSDRDPHSPNEGFWFSHLLWLFDTGYLVEKCGRRTNVEDLKRQWYYKFLQRTV
LYHILTFGFLLYYFGGLSFLTWGMGIGVAMEHHVTCLINSLCHVWGSRTWKTNDTSRNVW
WLSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSESQRRR
MAMVR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgtcagcctcggagaaggaggagaataacaagaaaatggcagcggacaaggct
gagatggggaggaagaagagggcaatgtgggaaagaaagtggaagagattggacattgtg
aaagcttttgcatctctctttgtccatttcctctgtctcttggcgcctttcaatttcact
tggccggctttaagagtcgccctcattgtctatacggtgggtgggctcggtatcaccgtc
tcttaccaccgaaatttggctcaccggagcttcaaagtccctaaatggctcgagtatttc
ttcgcttattgcggccttcttgccattcagggagatccgattgattgggtgagcacacat
cgataccatcaccagtttacagattcggatagggacccacatagtcctaacgaaggattt
tggttcagtcacctcctatggctatttgataccggttatcttgtagaaaagtgtggaaga
aggacaaatgtggaggacttaaagaggcagtggtactataaattcctccaaagaacagtc
ctttaccacattctaacatttggtttcctcctctattactttggtggtttgtcttttctt
acttggggaatgggtattggggtagcaatggagcatcatgtgacttgcctcataaactct
ctttgccatgtttggggaagccgaacttggaagactaatgacacttcccgtaacgtttgg
tggctatcagtattctcgtttggagagagctggcacaacaatcaccacgccttcgaatcc
tcggcgagacaaggcttagaatggtggcaaatcgacatttcttggtatattgtccgcttt
ctcgagattatcggtttggctactgatgttaagttgccttccgagagtcaacgtcgtcgt
atggcaatggttcgttga

DBGET integrated database retrieval system