KEGG   Arabidopsis thaliana (thale cress): AT1G06080Help
Entry
AT1G06080         CDS       T00041                                 

Gene name
ADS1
Definition
(RefSeq) delta 9 desaturase 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 837117
NCBI-ProteinID: NP_172098
MIPS: AT1G06080.1
TAIR: AT1G06080
Araport: AT1G06080
UniProt: O65797
Position
1
AA seq 305 aa AA seqDB search
MSLSASEKEENNKKMAADKAEMGRKKRAMWERKWKRLDIVKAFASLFVHFLCLLAPFNFT
WPALRVALIVYTVGGLGITVSYHRNLAHRSFKVPKWLEYFFAYCGLLAIQGDPIDWVSTH
RYHHQFTDSDRDPHSPNEGFWFSHLLWLFDTGYLVEKCGRRTNVEDLKRQWYYKFLQRTV
LYHILTFGFLLYYFGGLSFLTWGMGIGVAMEHHVTCLINSLCHVWGSRTWKTNDTSRNVW
WLSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSESQRRR
MAMVR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgtcagcctcggagaaggaggagaataacaagaaaatggcagcggacaaggct
gagatggggaggaagaagagggcaatgtgggaaagaaagtggaagagattggacattgtg
aaagcttttgcatctctctttgtccatttcctctgtctcttggcgcctttcaatttcact
tggccggctttaagagtcgccctcattgtctatacggtgggtgggctcggtatcaccgtc
tcttaccaccgaaatttggctcaccggagcttcaaagtccctaaatggctcgagtatttc
ttcgcttattgcggccttcttgccattcagggagatccgattgattgggtgagcacacat
cgataccatcaccagtttacagattcggatagggacccacatagtcctaacgaaggattt
tggttcagtcacctcctatggctatttgataccggttatcttgtagaaaagtgtggaaga
aggacaaatgtggaggacttaaagaggcagtggtactataaattcctccaaagaacagtc
ctttaccacattctaacatttggtttcctcctctattactttggtggtttgtcttttctt
acttggggaatgggtattggggtagcaatggagcatcatgtgacttgcctcataaactct
ctttgccatgtttggggaagccgaacttggaagactaatgacacttcccgtaacgtttgg
tggctatcagtattctcgtttggagagagctggcacaacaatcaccacgccttcgaatcc
tcggcgagacaaggcttagaatggtggcaaatcgacatttcttggtatattgtccgcttt
ctcgagattatcggtttggctactgatgttaagttgccttccgagagtcaacgtcgtcgt
atggcaatggttcgttga

DBGET integrated database retrieval system