KEGG   Arabidopsis thaliana (thale cress): AT1G06780Help
Entry
AT1G06780         CDS       T00041                                 

Gene name
GAUT6
Definition
probable galacturonosyltransferase 6
Orthology
K13648  
alpha-1,4-galacturonosyltransferase [EC:2.4.1.43]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT1G06780 (GAUT6)
   00520 Amino sugar and nucleotide sugar metabolism
    AT1G06780 (GAUT6)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.43  polygalacturonate 4-alpha-galacturonosyltransferase
     AT1G06780 (GAUT6)
Glycosyltransferases [BR:ath01003]
 Polysaccharide
  Structural polysaccharide
   AT1G06780 (GAUT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 602 aa AA seqDB search
MKQIRRWQRILILALLSISVFAPLIFVSNRLKSITPVGQFRLLSFLFSFHCRREFIEELS
KIRFTTNDLRLSAIEHEDGEGLKGPRLILFKDGEFNSSAESDGGNTYKNREEQVIVSQKM
TVSSDEKGQILPTVNQLANKTDFKPPLSKGEKNTRVQPDRATDVKTKEIRDKIIQAKAYL
NFAPPGSNSQVVKELRGRLKELERSVGDATKDKDLSKGALRRVKPMENVLYKASRVFNNC
PAIATKLRAMNYNTEEQVQAQKNQAAYLMQLAARTTPKGLHCLSMRLTSEYFSLDPEKRQ
MPNQQNYFDANFNHYVVFSDNVLASSVVVNSTISSSKEPERIVFHVVTDSLNYPAISMWF
LLNIQSKATIQILNIDDMDVLPRDYDQLLMKQNSNDPRFISTLNHARFYLPDIFPGLNKM
VLLDHDVVVQRDLSRLWSIDMKGKVVGAVETCLEGESSFRSMSTFINFSDTWVAGKFSPR
ACTWAFGMNLIDLEEWRIRKLTSTYIKYFNLGTKRPLWKAGSLPIGWLTFYRQTLALDKR
WHVMGLGRESGVKAVDIEQAAVIHYDGVMKPWLDIGKENYKRYWNIHVPYHHTYLQQCNL
QA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaattcgtcgatggcagaggattttgatcctcgctctgctatcgatatctgta
ttcgctccgcttattttcgtatcgaatcggcttaagagcatcactcccgttggtcagttt
cgtctcctctccttcttattttcatttcattgtcgtagagaatttattgaagagttatcc
aaaattagattcacgacaaatgaccttagacttagcgctattgaacatgaggatggagaa
ggcttgaaggggccaaggctcattctcttcaaggatggggagtttaattcgtctgctgaa
agtgatggtggtaatacttacaaaaacagggaagaacaagtgattgtttcacagaagatg
acagttagctctgatgaaaagggtcaaattctaccaacagtcaaccaacttgctaataaa
acggatttcaagccccctttatctaagggtgaaaagaacacaagggttcagcccgacaga
gcaacagatgtgaaaacgaaggagatcagagacaaaattattcaagctaaagcctacctg
aatttcgctccacctggaagtaactctcaagttgtgaaggagttgagaggtcggctgaaa
gagctggaacggtctgttggtgatgcaacaaaggacaaggacttatcaaagggcgctctc
cgcagggtgaagcccatggaaaatgtgttatataaggctagtcgtgtctttaacaattgc
cctgccatcgctaccaaactccgtgccatgaattataacacagaagaacaagttcaggcg
cagaaaaatcaagcagcgtatctaatgcagcttgcagcaaggaccaccccaaaagggctt
cactgtctctcaatgcggctgacatcagaatacttttcactggatcctgaaaaaaggcag
atgcctaaccagcaaaattattttgacgctaatttcaatcattatgttgtcttctctgac
aatgttttggcttcttcagtcgttgttaactctacgatatcttcatcaaaggagccagaa
agaatagtcttccatgtcgtgactgattcacttaattacccagcaatctcaatgtggttt
ctgctaaacattcaaagtaaagctactatccaaatcctaaacattgatgatatggatgtc
ctgcctagagattatgatcaattactgatgaagcaaaactctaatgacccaagattcatt
tctacactcaatcacgcacgcttctatctcccggatatattcccgggtttgaacaagatg
gtactcttggaccatgatgtagttgttcaaagagatttaagtagactgtggagcattgat
atgaaaggaaaggtggttggagctgtagagacttgtcttgaaggtgaatcttcatttcga
tcaatgagcacatttattaatttctcagacacatgggtcgctgggaaatttagtcctaga
gcttgcacatgggctttcgggatgaatctaattgatctcgaagaatggagaatacggaag
ttgacttctacatacataaaatacttcaacctgggaacaaagagaccattgtggaaagct
gggagcttaccaataggttggttgactttctataggcaaacattagcattggacaagaga
tggcatgtgatggggttaggtcgcgaatcaggagtcaaagcggttgacatcgaacaagcg
gcagttatacactacgatggggtcatgaagccgtggttggacattggaaaagagaattac
aaacgttactggaacatacacgtcccttaccatcacacctacttgcaacagtgcaatctt
caagcttga

DBGET integrated database retrieval system