KEGG   Arabidopsis thaliana (thale cress): AT1G06780Help
Entry
AT1G06780         CDS       T00041                                 

Gene name
GAUT6
Definition
probable galacturonosyltransferase 6
Orthology
K13648  
alpha-1,4-galacturonosyltransferase [EC:2.4.1.43]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ath00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ath00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 602 aa AA seqDB search
MKQIRRWQRILILALLSISVFAPLIFVSNRLKSITPVGQFRLLSFLFSFHCRREFIEELS
KIRFTTNDLRLSAIEHEDGEGLKGPRLILFKDGEFNSSAESDGGNTYKNREEQVIVSQKM
TVSSDEKGQILPTVNQLANKTDFKPPLSKGEKNTRVQPDRATDVKTKEIRDKIIQAKAYL
NFAPPGSNSQVVKELRGRLKELERSVGDATKDKDLSKGALRRVKPMENVLYKASRVFNNC
PAIATKLRAMNYNTEEQVQAQKNQAAYLMQLAARTTPKGLHCLSMRLTSEYFSLDPEKRQ
MPNQQNYFDANFNHYVVFSDNVLASSVVVNSTISSSKEPERIVFHVVTDSLNYPAISMWF
LLNIQSKATIQILNIDDMDVLPRDYDQLLMKQNSNDPRFISTLNHARFYLPDIFPGLNKM
VLLDHDVVVQRDLSRLWSIDMKGKVVGAVETCLEGESSFRSMSTFINFSDTWVAGKFSPR
ACTWAFGMNLIDLEEWRIRKLTSTYIKYFNLGTKRPLWKAGSLPIGWLTFYRQTLALDKR
WHVMGLGRESGVKAVDIEQAAVIHYDGVMKPWLDIGKENYKRYWNIHVPYHHTYLQQCNL
QA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaattcgtcgatggcagaggattttgatcctcgctctgctatcgatatctgta
ttcgctccgcttattttcgtatcgaatcggcttaagagcatcactcccgttggtcagttt
cgtctcctctccttcttattttcatttcattgtcgtagagaatttattgaagagttatcc
aaaattagattcacgacaaatgaccttagacttagcgctattgaacatgaggatggagaa
ggcttgaaggggccaaggctcattctcttcaaggatggggagtttaattcgtctgctgaa
agtgatggtggtaatacttacaaaaacagggaagaacaagtgattgtttcacagaagatg
acagttagctctgatgaaaagggtcaaattctaccaacagtcaaccaacttgctaataaa
acggatttcaagccccctttatctaagggtgaaaagaacacaagggttcagcccgacaga
gcaacagatgtgaaaacgaaggagatcagagacaaaattattcaagctaaagcctacctg
aatttcgctccacctggaagtaactctcaagttgtgaaggagttgagaggtcggctgaaa
gagctggaacggtctgttggtgatgcaacaaaggacaaggacttatcaaagggcgctctc
cgcagggtgaagcccatggaaaatgtgttatataaggctagtcgtgtctttaacaattgc
cctgccatcgctaccaaactccgtgccatgaattataacacagaagaacaagttcaggcg
cagaaaaatcaagcagcgtatctaatgcagcttgcagcaaggaccaccccaaaagggctt
cactgtctctcaatgcggctgacatcagaatacttttcactggatcctgaaaaaaggcag
atgcctaaccagcaaaattattttgacgctaatttcaatcattatgttgtcttctctgac
aatgttttggcttcttcagtcgttgttaactctacgatatcttcatcaaaggagccagaa
agaatagtcttccatgtcgtgactgattcacttaattacccagcaatctcaatgtggttt
ctgctaaacattcaaagtaaagctactatccaaatcctaaacattgatgatatggatgtc
ctgcctagagattatgatcaattactgatgaagcaaaactctaatgacccaagattcatt
tctacactcaatcacgcacgcttctatctcccggatatattcccgggtttgaacaagatg
gtactcttggaccatgatgtagttgttcaaagagatttaagtagactgtggagcattgat
atgaaaggaaaggtggttggagctgtagagacttgtcttgaaggtgaatcttcatttcga
tcaatgagcacatttattaatttctcagacacatgggtcgctgggaaatttagtcctaga
gcttgcacatgggctttcgggatgaatctaattgatctcgaagaatggagaatacggaag
ttgacttctacatacataaaatacttcaacctgggaacaaagagaccattgtggaaagct
gggagcttaccaataggttggttgactttctataggcaaacattagcattggacaagaga
tggcatgtgatggggttaggtcgcgaatcaggagtcaaagcggttgacatcgaacaagcg
gcagttatacactacgatggggtcatgaagccgtggttggacattggaaaagagaattac
aaacgttactggaacatacacgtcccttaccatcacacctacttgcaacagtgcaatctt
caagcttga

DBGET integrated database retrieval system