KEGG   Arabidopsis thaliana (thale cress): AT1G07210Help
Entry
AT1G07210         CDS       T00041                                 

Definition
(RefSeq) ribosomal protein S18
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 261 aa AA seqDB search
MSIARFATRSLNNVTFLRPFRPIVSRSLATNANEDPNQNRSSFDSSDNLDSLFGDYTGND
EKSNDFFQHLSKAEKDKRDFNGYNRSGGSRYSGGGSMSKDETFDPSSDGVDGKLKEAALA
YNMDEGDGFKEYSFRPDFNNSWGMNNFPRMQKQMQNPRQNNSKSEVTTEEVLKNADFRNV
RFLANFITEAGIIIKRKQTGISAKAQRKIAREIKTARAFGLMPFTTMGTKAFQFGKTMEN
RDQDFEYEVLDDDDEFDEGNA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgctcgtttcgctactcggtcactcaacaacgtaactttccttcgaccattt
cgtcccatcgtctctagaagcctcgccaccaacgccaacgaagatccaaaccagaatcga
tcttcttttgactcatcggacaatttggattcgttgtttggcgattacactggcaacgat
gagaaaagcaatgatttcttccagcatcttagtaaagcggagaaagataagcgcgatttc
aatggctataatagatcaggagggtcgagatactccggtggtggttcaatgagcaaagac
gagaccttcgatccttcatctgatggtgttgatggaaaattgaaagaagctgcactagct
tacaatatggatgaaggagatggctttaaggagtactcttttaggcccgatttcaacaac
agttggggcatgaataacttccctaggatgcaaaaacagatgcaaaatcctagacagaat
aatagcaagtctgaggtaactactgaggaagttctgaagaatgctgatttcaggaatgtt
aggttccttgcaaacttcatcactgaagctgggatcattattaagaggaagcagactggc
attagcgcaaaggctcaaagaaagattgctagagagatcaaaacagcccgtgcatttggg
ctgatgcctttcacaacaatgggtacaaaggcatttcagttcgggaaaaccatggagaac
agagaccaagatttcgagtatgaagtgcttgatgatgatgatgagtttgacgagggaaat
gcttga

DBGET integrated database retrieval system