KEGG   Arabidopsis thaliana (thale cress): AT1G07790Help
Entry
AT1G07790         CDS       T00041                                 

Gene name
HTB1
Definition
(RefSeq) Histone superfamily protein
  KO
K11252  histone H2B
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    AT1G07790 (HTB1)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT1G07790 (HTB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 837293
NCBI-ProteinID: NP_172258
MIPS: AT1G07790.1
TAIR: AT1G07790
Araport: AT1G07790
UniProt: Q9LQQ4
Position
1
AA seq 148 aa AA seqDB search
MAPRAEKKPAEKKTAAERPVEENKAAEKAPAEKKPKAGKKLPPKEAGDKKKKRSKKNVET
YKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKKPTITSREIQT
AVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaagagccgagaagaagcccgccgagaaaaaaaccgccgctgagagaccggtg
gaagagaacaaggctgctgaaaaggctccggcggagaagaaacccaaggcggggaagaaa
ttgccaccaaaggaagccggtgacaagaagaagaagcgatctaagaaaaacgtcgaaacc
tacaagatctacatcttcaaggtgctgaagcaggttcatccagatatcggaatttcaagc
aaagccatggggattatgaacagtttcatcaacgacatattcgagaagctagctcaggaa
tcttcgaaactcgctaggtacaacaagaagccgaccattacatctcgcgagatccagacg
gctgtgagactcgtcctccccggtgaactcgctaaacacgccgtctctgaaggtaccaag
gcggttaccaagtttactagctcttga

DBGET integrated database retrieval system