KEGG   Arabidopsis thaliana (thale cress): AT1G07880Help
Entry
AT1G07880         CDS       T00041                                 

Gene name
ATMPK13
Definition
mitogen-activated protein kinase 13
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 363 aa AA seqDB search
MEKREDGGILTYDGRYVMYNVLGNIFELSSKYIPPIEPIGRGAYGIVCCATNSETNEEVA
IKKIANAFDNRVDAKRTLREIKLLSHMDHDNVIKIKDIIELPEKERFEDVYIVYELMDTD
LHQIIRSTQTLTDDHCQYFLYQILRGLKYIHSANVLHRDLKPSNLVLNTNCDLKICDFGL
ARTSNETEIMTEYVVTRWYRAPELLLNSSEYTGAIDIWSVGCIFMEILRRETLFPGKDYV
QQLKLITELLGSPDDSDLDFLRSDNARKYVKQLPHVQKQSFREKFPNISPMALDLAEKML
VFDPSKRITVDEALKQPYLASLHEINEEPTCPTPFSFDFEETALDEQDIKELVWRESLHF
KNM
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaagggaagatggagggatcttgacatatgatggtagatatgttatgtacaat
gtactcggtaacattttcgagctatcttcaaaatacatccctcctattgaacccatcggc
cgaggtgcttatggtattgtctgctgtgctacaaactcagagacaaatgaagaggttgct
ataaagaagatagcaaacgcgtttgacaacagagttgatgctaaaagaactctccgagag
atcaagctcctttcccacatggatcatgacaatgttatcaaaattaaagatataattgag
ctaccagagaaagaaaggttcgaagatgtatatattgtttatgagttgatggatacagat
ttgcaccagatcattagatccactcaaactctaactgatgaccattgtcagtacttcctt
taccaaattttgagaggccttaagtacatacactctgcaaatgttcttcaccgcgatctg
aaaccgagcaacttggttctgaatacgaactgtgacctgaaaatctgtgattttgggcta
gcaagaacgtcgaatgagacagagataatgactgagtatgttgtgacgagatggtaccgt
gcacctgaattgcttctcaacagctctgaatacacaggagctattgacatttggtctgtt
ggttgcattttcatggagatacttagaagagagacgcttttccctggtaaagattacgtt
cagcagctgaaacttattactgagctcttagggtcaccagatgactcggatctcgacttc
ttgagaagcgataatgcgcggaagtacgtaaaacaactcccacatgttcaaaaacaatca
ttcagagaaaagtttccaaacatttccccaatggctctagatcttgctgaaaagatgcta
gttttcgatccttcaaagcgcatcacagtggatgaagcattgaagcagccgtacttggca
agtctccatgagatcaacgaagaaccaacatgtcctactcctttcagctttgactttgag
gagacagccttagatgaacaagacatcaaggagcttgtctggagagagtctttacacttc
aagaatatgtaa

DBGET integrated database retrieval system