KEGG   Arabidopsis thaliana (thale cress): AT1G07880Help
Entry
AT1G07880         CDS       T00041                                 

Gene name
ATMPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ath00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    AT1G07880 (ATMPK13)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AT1G07880 (ATMPK13)
Protein kinases [BR:ath01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   AT1G07880 (ATMPK13)
Chromosome [BR:ath03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     AT1G07880 (ATMPK13)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT1G07880 (ATMPK13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 363 aa AA seqDB search
MEKREDGGILTYDGRYVMYNVLGNIFELSSKYIPPIEPIGRGAYGIVCCATNSETNEEVA
IKKIANAFDNRVDAKRTLREIKLLSHMDHDNVIKIKDIIELPEKERFEDVYIVYELMDTD
LHQIIRSTQTLTDDHCQYFLYQILRGLKYIHSANVLHRDLKPSNLVLNTNCDLKICDFGL
ARTSNETEIMTEYVVTRWYRAPELLLNSSEYTGAIDIWSVGCIFMEILRRETLFPGKDYV
QQLKLITELLGSPDDSDLDFLRSDNARKYVKQLPHVQKQSFREKFPNISPMALDLAEKML
VFDPSKRITVDEALKQPYLASLHEINEEPTCPTPFSFDFEETALDEQDIKELVWRESLHF
KNM
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaagggaagatggagggatcttgacatatgatggtagatatgttatgtacaat
gtactcggtaacattttcgagctatcttcaaaatacatccctcctattgaacccatcggc
cgaggtgcttatggtattgtctgctgtgctacaaactcagagacaaatgaagaggttgct
ataaagaagatagcaaacgcgtttgacaacagagttgatgctaaaagaactctccgagag
atcaagctcctttcccacatggatcatgacaatgttatcaaaattaaagatataattgag
ctaccagagaaagaaaggttcgaagatgtatatattgtttatgagttgatggatacagat
ttgcaccagatcattagatccactcaaactctaactgatgaccattgtcagtacttcctt
taccaaattttgagaggccttaagtacatacactctgcaaatgttcttcaccgcgatctg
aaaccgagcaacttggttctgaatacgaactgtgacctgaaaatctgtgattttgggcta
gcaagaacgtcgaatgagacagagataatgactgagtatgttgtgacgagatggtaccgt
gcacctgaattgcttctcaacagctctgaatacacaggagctattgacatttggtctgtt
ggttgcattttcatggagatacttagaagagagacgcttttccctggtaaagattacgtt
cagcagctgaaacttattactgagctcttagggtcaccagatgactcggatctcgacttc
ttgagaagcgataatgcgcggaagtacgtaaaacaactcccacatgttcaaaaacaatca
ttcagagaaaagtttccaaacatttccccaatggctctagatcttgctgaaaagatgcta
gttttcgatccttcaaagcgcatcacagtggatgaagcattgaagcagccgtacttggca
agtctccatgagatcaacgaagaaccaacatgtcctactcctttcagctttgactttgag
gagacagccttagatgaacaagacatcaaggagcttgtctggagagagtctttacacttc
aagaatatgtaa

DBGET integrated database retrieval system