KEGG   Arabidopsis thaliana (thale cress): AT1G07890Help
Entry
AT1G07890         CDS       T00041                                 

Gene name
APX1
Definition
(RefSeq) L-ascorbate peroxidase 1
  KO
K00434  
L-ascorbate peroxidase [EC:1.11.1.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Ascorbate and aldarate metabolism
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    AT1G07890 (APX1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AT1G07890 (APX1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.11  L-ascorbate peroxidase
     AT1G07890 (APX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 250 aa AA seqDB search
MTKNYPTVSEDYKKAVEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTM
RFDAEQAHGANSGIHIALRLLDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGRE
DKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT
SNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPLVEKYAADEDAFFADYAEAHM
KLSELGFADA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagaactacccaaccgtgagcgaagattacaagaaggctgttgagaagtgcagg
aggaagctcagaggtttgatcgctgagaagaactgtgcacccatcatggtccgactcgca
tggcactctgctggaactttcgattgtcaatcaaggactggaggtccattcggaacaatg
aggtttgacgctgagcaagctcatggagccaacagtggtatccacattgctcttaggttg
ttggaccccatcagggagcaattccctaccatctcttttgctgatttccatcagcttgct
ggtgttgtggccgttgaagttactggtggccctgacattcctttccaccctggaagagag
gacaagccccaaccacctccagagggtcgtcttcctgatgctaccaagggttgtgaccat
ttgagagatgtctttgctaagcagatgggcttatctgacaaagacattgtcgctttatct
ggtgcccacactctgggacgatgccacaaggataggtctggcttcgaaggtgcatggaca
tcaaaccctctaatcttcgacaactcttacttcaaggaactcttgagcggagagaaggaa
ggccttcttcagcttgtctctgacaaagcactattggacgaccctgttttccgtcctttg
gtcgagaaatacgctgctgatgaagatgcctttttcgctgattacgctgaggcccacatg
aagctttctgagcttgggtttgctgatgcttaa

DBGET integrated database retrieval system