KEGG   Arabidopsis thaliana (thale cress): AT1G08130Help
Entry
AT1G08130         CDS       T00041                                 

Gene name
LIG1
Definition
DNA ligase 1
Orthology
K10747  
DNA ligase 1 [EC:6.5.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:ath03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ath03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ath03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ath03430]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 790 aa AA seqDB search
MLAIRSSNYLRCIPSLCTKTQISQFSSVLISFSRQISHLRLSSCHRAMSSSRPSAFDALM
SNARAAAKKKTPQTTNLSRSPNKRKIGETQDANLGKTIVSEGTLPKTEDLLEPVSDSANP
RSDTSSIAEDSKTGAKKAKTLSKTDEMKSKIGLLKKKPNDFDPEKMSCWEKGERVPFLFV
ALAFDLISNESGRIVITDILCNMLRTVIATTPEDLVATVYLSANEIAPAHEGVELGIGES
TIIKAISEAFGRTEDHVKKQNTELGDLGLVAKGSRSTQTMMFKPEPLTVVKVFDTFRQIA
KESGKDSNEKKKNRMKALLVATTDCEPLYLTRLLQAKLRLGFSGQTVLAALGQAAVYNEE
HSKPPPNTKSPLEEAAKIVKQVFTVLPVYDIIVPALLSGGVWNLPKTCNFTLGVPIGPML
AKPTKGVAEILNKFQDIVFTCEYKYDGERAQIHFMEDGTFEIYSRNAERNTGKYPDVALA
LSRLKKPSVKSFILDCEVVAFDREKKKILPFQILSTRARKNVNVNDIKVGVCIFAFDMLY
LNGQQLIQENLKIRREKLYESFEEDPGYFQFATAVTSNDIDEIQKFLDASVDVGCEGLII
KTLDSDATYEPAKRSNNWLKLKKDYMDSIGDSVDLVPIAAFHGRGKRTGVYGAFLLACYD
VDKEEFQSICKIGTGFSDAMLDERSSSLRSQVIATPKQYYRVGDSLNPDVWFEPTEVWEV
KAADLTISPVHRAATGIVDPDKGISLRFPRLLRVREDKKPEEATSSEQIADLYQAQKHNH
PSNEVKGDDD
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgttagcgattcgatcgtcgaattacctccgatgcataccttctctctgtactaaaacc
caaatctctcaattctcctccgtgttaatctcttttagccgccaaatttcccacttgcgt
cttagctcgtgccatagagccatgtcttcttcccgcccttctgcatttgatgctctcatg
tccaatgctcgtgcagccgccaagaagaagactccccagacaactaatttgtctcgctcg
ccgaacaaaaggaaaattggagaaacccaagatgctaatttgggcaaaactattgtttcc
gaaggtacacttccaaaaacggaggatctgctggagcctgtttctgattctgcaaatccc
agatcggatacatcgtcaattgcggaggattcaaagacgggagcgaaaaaggctaagact
ttgagcaagacagacgaaatgaagagcaaaattggattgctgaagaagaagccgaatgat
ttcgatcctgaaaaaatgtcttgctgggagaaaggggagagagttccgtttctgtttgtc
gcattggcttttgatctgatctcaaatgaaagtggccggattgtgattactgatattctg
tgtaacatgttgagaactgttattgccactactcctgaggatttggtcgctactgtttat
ctttcggcgaatgagattgccccggctcatgaaggtgtagaattgggaattggtgagagt
acaattatcaaggctatctctgaggcttttggtagaactgaggatcatgttaagaagcag
aatacggaactgggagacttgggacttgtagcaaaaggaagccgttcgactcagactatg
atgttcaagcccgaaccattgactgttgtcaaggttttcgatacgtttcgacaaattgct
aaggaaagtggaaaagatagtaatgaaaagaagaagaatcgaatgaaggcacttcttgtg
gcgacaacagactgtgaacctctttacttaacacgattacttcaggcaaaattgcggtta
gggttctcaggtcagactgtcttagccgcattgggacaagccgctgtatataatgaagag
cactcaaagccacccccaaataccaagtctcctttagaagaggctgcaaagattgttaaa
caagtattcactgtacttcctgtctatgacattattgttcctgctcttctaagtggcggt
gtgtggaatcttccaaaaacttgtaactttacattgggtgttccaattggacccatgctt
gcaaaaccaaccaaaggtgtagctgagatactgaataaattccaggacatcgttttcaca
tgtgaatacaaatatgatggggaacgtgcacagatacattttatggaggatggtacattt
gagatatacagtcgaaatgctgaaagaaacactgggaagtacccggatgttgctcttgcg
ttatcaagattaaagaagccttctgtgaaatcttttattctggattgtgaagttgttgct
ttcgacagggagaaaaagaaaattcttccgttccagattttgagcactcgagcccgtaaa
aatgtgaatgtcaatgatatcaaggttggcgtatgcatctttgcttttgacatgttatat
ctaaatggccaacaacttatccaggagaatcttaaaattcgccgagagaagctatacgaa
tcatttgaggaagatcctgggtatttccagtttgcaactgctgtaacatctaacgatatc
gatgaaatacaaaagtttcttgacgcttctgttgatgttggctgcgaaggtttaatcatt
aaaacattggactcagatgctacctatgagcctgcaaagcgatcaaataattggctaaaa
ctgaagaaagactatatggacagcattggggactctgtggatcttgtaccaattgctgct
ttccatggacgtggaaaacgcacaggtgtctatggtgcatttttactcgcttgctatgat
gttgataaggaagagttccagagcatttgtaaaattggtactggattttctgatgccatg
cttgacgagcggtcgtccagtcttcgctctcaagtgattgctactccaaaacaatactac
cgagttggagacagcctcaatccagatgtttggtttgagcccactgaggtctgggaagtg
aaagcagctgacttaacaattagccctgtgcaccgtgcagctactggcatagtggatcct
gataaggggatttctcttcgttttcctcgtctacttcgtgtacgggaagacaagaagccc
gaggaagcaacatcatctgagcagattgctgatttgtaccaagctcagaaacacaatcat
ccaagtaatgaagtcaaaggtgacgatgattga

DBGET integrated database retrieval system