KEGG   Arabidopsis thaliana (thale cress): AT1G08170Help
Entry
AT1G08170         CDS       T00041                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 243 aa AA seqDB search
MAPRKPKVVSVTKKKKVVEETIKVTVTEEGDPCVITETANDQETQDLTFSIPVGENVTTV
EIPVEVPDERSLPVGENVTTVKIPVDDRDESSPQPPETPVEVRDEPSPQPPETPASKSEG
TLKKTDKVEKKQENKKKKKKKKRDDLAGDEYRRYVYKVMKQVHPDLGITSKAMTVVNMFM
GDMFERIAQEAARLSDYTKRRTLSSREIEAAVRLVLPGELSRHAVAEGSKAVSNFVGYDS
RKR
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgagaaaaccaaaggttgtttccgtgacgaagaagaagaaagtagtggaagag
acaatcaaagtaaccgtcacggaagaaggagatccgtgtgtgatcaccgagacagcgaac
gatcaagagacgcaagatctcactttctccattcccgtcggagaaaacgttactaccgtt
gagattccagtggaggttccagacgaacggtcacttcccgtcggagaaaacgttaccacc
gttaagattccggtggatgatcgagatgaaagttcacctcagccgccggagactccggtg
gaggttcgagatgaaccttcacctcagccaccggaaactcccgcttccaagagtgaaggc
actttgaagaaaacagataaggttgagaagaagcaggagaataagaagaagaagaaaaag
aagaagagagacgatttggcgggagatgagtataggagatatgtgtataaggtgatgaag
caagtgcatccggatttaggtataacgtcgaaggcgatgacggtggtgaacatgttcatg
ggagatatgttcgagaggatagcgcaggaggcagcgaggttaagcgattatacaaagcgg
aggacgttgtcttcgagggagatcgaagcagcggttaggttggttctgcctggtgaactt
agccgccacgctgtcgctgaaggctctaaagctgttagtaacttcgttggttatgatagt
aggaaacgttag

DBGET integrated database retrieval system