KEGG   Arabidopsis thaliana (thale cress): AT1G08170Help
Entry
AT1G08170         CDS       T00041                                 

Definition
(RefSeq) Histone superfamily protein
  KO
K11252  histone H2B
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    AT1G08170
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT1G08170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TAF
Motif
Other DBs
NCBI-GeneID: 837338
NCBI-ProteinID: NP_172295
MIPS: AT1G08170.1
TAIR: AT1G08170
Araport: AT1G08170
UniProt: Q9SGE3
Position
1
AA seq 243 aa AA seqDB search
MAPRKPKVVSVTKKKKVVEETIKVTVTEEGDPCVITETANDQETQDLTFSIPVGENVTTV
EIPVEVPDERSLPVGENVTTVKIPVDDRDESSPQPPETPVEVRDEPSPQPPETPASKSEG
TLKKTDKVEKKQENKKKKKKKKRDDLAGDEYRRYVYKVMKQVHPDLGITSKAMTVVNMFM
GDMFERIAQEAARLSDYTKRRTLSSREIEAAVRLVLPGELSRHAVAEGSKAVSNFVGYDS
RKR
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgagaaaaccaaaggttgtttccgtgacgaagaagaagaaagtagtggaagag
acaatcaaagtaaccgtcacggaagaaggagatccgtgtgtgatcaccgagacagcgaac
gatcaagagacgcaagatctcactttctccattcccgtcggagaaaacgttactaccgtt
gagattccagtggaggttccagacgaacggtcacttcccgtcggagaaaacgttaccacc
gttaagattccggtggatgatcgagatgaaagttcacctcagccgccggagactccggtg
gaggttcgagatgaaccttcacctcagccaccggaaactcccgcttccaagagtgaaggc
actttgaagaaaacagataaggttgagaagaagcaggagaataagaagaagaagaaaaag
aagaagagagacgatttggcgggagatgagtataggagatatgtgtataaggtgatgaag
caagtgcatccggatttaggtataacgtcgaaggcgatgacggtggtgaacatgttcatg
ggagatatgttcgagaggatagcgcaggaggcagcgaggttaagcgattatacaaagcgg
aggacgttgtcttcgagggagatcgaagcagcggttaggttggttctgcctggtgaactt
agccgccacgctgtcgctgaaggctctaaagctgttagtaacttcgttggttatgatagt
aggaaacgttag

DBGET integrated database retrieval system