KEGG   Arabidopsis thaliana (thale cress): AT1G09310Help
Entry
AT1G09310         CDS       T00041                                 

Definition
(RefSeq) plant/protein (Protein of unknown function, DUF538)
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF538
Motif
Other DBs
NCBI-GeneID: 837452
NCBI-ProteinID: NP_563841
MIPS: AT1G09310.1
TAIR: AT1G09310
Araport: AT1G09310
UniProt: Q9ZPZ4 A0A178W8C5
Position
1
AA seq 179 aa AA seqDB search
MGLVTEEVRAKAEMYTGDEICREKTKCFLKEISMPNGLLPLKDIEEVGYDRESGVVWLKQ
KKSITHKFTEIDKLVSYGTEVTAIVETGKIKKLTGVKAKELLIWVTINEIYTEEPPTKIT
FKTPTTLSRTFPVTAFIVPEEPAKEEPAKEEPAKEKSSEATEAKEAVAIKEAVAVKEAA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgggtttggttacagaggaggtgagagctaaggcagagatgtacaccggagatgagata
tgtagagagaagacaaagtgtttcctcaaggaaatatctatgcccaatggtttattacca
ttgaaggatatagaagaggttgggtatgacagagagtcaggtgttgtatggctgaagcag
aagaagagcatcactcacaagttcacagagatagataagcttgtctcctatggaaccgaa
gtcacagccattgttgagaccgggaaaatcaagaagctcactggagtcaaagccaaggaa
cttcttatttgggtcactatcaatgagatctataccgaggaaccccctaccaagatcacg
ttcaagacaccgaccacactgtccaggactttcccggtcacagcttttatagtcccagaa
gaacctgccaaggaggaacctgccaaagaggaacctgccaaggagaagagcagcgaagcc
accgaggccaaggaggctgttgcaatcaaggaggctgtcgcagtcaaagaggcggcctaa

DBGET integrated database retrieval system