KEGG   Arabidopsis thaliana (thale cress): AT1G09570Help
Entry
AT1G09570         CDS       T00041                                 

Gene name
PHYA
Definition
(RefSeq) phytochrome A
  KO
K12120  
phytochrome A
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    AT1G09570 (PHYA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 1122 aa AA seqDB search
MSGSRPTQSSEGSRRSRHSARIIAQTTVDAKLHADFEESGSSFDYSTSVRVTGPVVENQP
PRSDKVTTTYLHHIQKGKLIQPFGCLLALDEKTFKVIAYSENASELLTMASHAVPSVGEH
PVLGIGTDIRSLFTAPSASALQKALGFGDVSLLNPILVHCRTSAKPFYAIIHRVTGSIII
DFEPVKPYEVPMTAAGALQSYKLAAKAITRLQSLPSGSMERLCDTMVQEVFELTGYDRVM
AYKFHEDDHGEVVSEVTKPGLEPYLGLHYPATDIPQAARFLFMKNKVRMIVDCNAKHARV
LQDEKLSFDLTLCGSTLRAPHSCHLQYMANMDSIASLVMAVVVNEEDGEGDAPDATTQPQ
KRKRLWGLVVCHNTTPRFVPFPLRYACEFLAQVFAIHVNKEVELDNQMVEKNILRTQTLL
CDMLMRDAPLGIVSQSPNIMDLVKCDGAALLYKDKIWKLGTTPSEFHLQEIASWLCEYHM
DSTGLSTDSLHDAGFPRALSLGDSVCGMAAVRISSKDMIFWFRSHTAGEVRWGGAKHDPD
DRDDARRMHPRSSFKAFLEVVKTRSLPWKDYEMDAIHSLQLILRNAFKDSETTDVNTKVI
YSKLNDLKIDGIQELEAVTSEMVRLIETATVPILAVDSDGLVNGWNTKIAELTGLSVDEA
IGKHFLTLVEDSSVEIVKRMLENALEGTEEQNVQFEIKTHLSRADAGPISLVVNACASRD
LHENVVGVCFVAHDLTGQKTVMDKFTRIEGDYKAIIQNPNPLIPPIFGTDEFGWCTEWNP
AMSKLTGLKREEVIDKMLLGEVFGTQKSCCRLKNQEAFVNLGIVLNNAVTSQDPEKVSFA
FFTRGGKYVECLLCVSKKLDREGVVTGVFCFLQLASHELQQALHVQRLAERTAVKRLKAL
AYIKRQIRNPLSGIMFTRKMIEGTELGPEQRRILQTSALCQKQLSKILDDSDLESIIEGC
LDLEMKEFTLNEVLTASTSQVMMKSNGKSVRITNETGEEVMSDTLYGDSIRLQQVLADFM
LMAVNFTPSGGQLTVSASLRKDQLGRSVHLANLEIRLTHTGAGIPEFLLNQMFGTEEDVS
EEGLSLMVSRKLVKLMNGDVQYLRQAGKSSFIITAELAAANK
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggctctaggccgactcagtcctctgagggctcaaggcgatcaaggcacagcgct
aggatcattgcgcagaccactgtagatgcgaaactccatgctgattttgaggagtcaggc
agctcctttgattactcaacctcagtgcgtgtcactggcccggttgtggagaatcagcca
ccaaggtctgacaaagttaccacgacttatcttcatcatatacagaagggaaagctgatt
cagcccttcggttgtttacttgccttggatgagaagaccttcaaagttattgcatacagc
gagaatgcatctgagctgttgacaatggccagtcatgcagttcctagtgttggcgaacac
cctgttctaggcattgggacagatataaggagtcttttcactgctcctagtgcgtctgca
ttgcagaaagcccttggatttggagatgtctctcttttgaatcccattcttgtgcactgc
aggacttctgcaaagcccttttatgcgattatccacagggttacagggagcatcatcatc
gactttgaacccgtgaagccttatgaagtccccatgacagctgctggtgccttacaatca
tacaagctcgctgccaaagcaatcactaggctgcaatctttacccagcgggagtatggaa
aggctttgtgatacaatggttcaagaggtttttgaactcacggggtatgacagggtgatg
gcttataagtttcatgaagatgatcacggtgaggttgtctccgaggttacaaaacctggg
ctggagccttatcttgggctgcattatcctgccaccgacatccctcaagcagcccgtttt
ctgtttatgaagaacaaggtccggatgatagttgattgcaatgcaaaacatgctagggtg
cttcaagatgaaaagctttcctttgaccttaccttgtgtggctccacccttagagcaccg
cacagctgccatttgcagtacatggccaacatggattcaattgcatctctggttatggcg
gttgtagttaacgaggaagatggagaaggggatgctcctgatgctactacacagcctcaa
aagagaaagagactatggggtttagtggtttgtcacaatacgactccgaggtttgttcca
tttcctctcaggtatgcctgtgagtttctagctcaagtgtttgccatacacgtcaataag
gaggtggaactcgataaccagatggtggagaagaacattttgcgcacgcagacactcttg
tgcgatatgctgatgcgtgatgctccactgggtattgtgtcgcaaagccccaacataatg
gaccttgtgaaatgtgatggagcagctctcttgtataaagacaagatatggaaactggga
acaactccaagtgagttccacctgcaggagatagcttcatggttgtgtgaataccacatg
gattcaacgggtttgagcactgatagtttgcatgacgccgggtttcctagggctctatct
ctcggggattcggtatgtgggatggcagctgtgaggatatcatcgaaagacatgattttc
tggttccgttctcataccgctggtgaagtgagatggggaggtgcgaagcatgatccagat
gatagggatgatgcaaggagaatgcacccaaggtcatcgttcaaggctttccttgaagtg
gtcaagacaaggagtttaccttggaaggactatgagatggatgccatacactccttgcaa
cttattttgaggaatgctttcaaggatagtgaaactactgatgtgaatacaaaggtcatt
tactcgaagctaaatgatctcaaaattgatggtatacaagaactagaagctgtgaccagt
gagatggttcgtttaattgagactgctacggtgccaatattggcggttgattctgatgga
ctggttaatggttggaacacgaaaattgctgagctgactggtctttcggttgatgaagca
atcgggaagcatttcctcacacttgttgaagattcttcagtggaaatcgttaaaaggatg
ctagagaacgcattagaaggaactgaggagcagaatgtccagtttgagatcaagacacat
ctgtccagggctgatgctgggccaataagtttagttgtaaatgcatgcgcaagtagagat
ctccatgaaaacgtggttggggtgtgttttgtagcccatgatcttactggccagaagact
gtgatggacaagtttacgcggattgaaggtgattacaaggcaatcatccaaaatccaaac
ccgctgatcccgccaatatttggtaccgatgagtttggatggtgcacagagtggaatcca
gcaatgtcaaagttaaccggtttgaagcgagaggaagtgattgacaaaatgctcttagga
gaagtatttgggacgcagaagtcatgttgtcgtctaaagaatcaagaagcctttgtaaac
cttgggattgtgctgaacaatgctgtgaccagtcaagatccagagaaagtatcgtttgct
ttctttacaagaggtggcaagtatgtggagtgtctgttgtgtgtgagtaagaaactggac
agggaaggtgtagtgacaggtgtcttctgtttcctgcaacttgccagccatgagctgcag
caagcgctccatgttcaacgtttagctgagcgaaccgcagtgaagagactaaaggctcta
gcatacataaaaagacagatcaggaatccgctatctgggatcatgtttacaaggaaaatg
atagagggtactgaattaggaccagagcaaagacggattttgcaaactagcgcgttatgt
cagaagcaactaagcaagatcctcgatgattcggatcttgaaagcatcattgaaggatgc
ttggatttggaaatgaaagaattcaccttaaatgaagtgttgactgcttccacaagtcaa
gtaatgatgaagagtaacggaaagagtgttcggataacaaatgagaccggagaagaagta
atgtctgacactttgtatggagacagtattaggcttcaacaagtcttggcagatttcatg
ctgatggctgtaaactttacaccatccggaggtcagctaactgtttcagcttccctgagg
aaggatcagctcgggcgttctgtgcatcttgctaatctagagatcaggttaacgcatacc
ggagctgggatacctgagtttttactaaaccaaatgtttgggactgaggaagatgtgtca
gaagaaggattgagcttaatggttagccggaaactggtgaagctgatgaatggagatgtt
cagtacttgagacaagctgggaaatcaagtttcattatcactgcggaactcgctgcagca
aacaagtag

DBGET integrated database retrieval system