KEGG   Arabidopsis thaliana (thale cress): AT1G09815Help
Entry
AT1G09815         CDS       T00041                                 

Gene name
POLD4
Definition
DNA polymerase delta subunit 4
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ath00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ath00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ath03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ath03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ath03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ath03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ath03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 124 aa AA seqDB search
MATTAKNLKGFYKQTKSNITGGISKSKPSSRKVAPKHAAAQGSDVTQPAALISHGSVDLN
EDYDKEEEMLRQFDMNITYGPCLGMTRLDRWERAVRLGMNPPNEIEKLLKTGKVQQDCLW
QGRV
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgacggcgaagaatttgaagggtttctacaagcagactaaaagcaatatcacc
ggaggtatctccaagtccaagccttcttcccggaaagtggctcccaaacacgcggcggct
caaggttctgatgttacccagcccgccgcattgatttcacacggctccgtcgatctcaac
gaggattatgacaaggaggaggagatgcttagacaatttgacatgaacatcacttatggt
ccgtgcctgggtatgacgagacttgatcgatgggagcgtgcagtgcgtcttgggatgaac
cctcccaatgaaatcgagaagcttttgaagaccgggaaagtccagcaagattgtctgtgg
caaggtcgtgtctag

DBGET integrated database retrieval system