KEGG   Arabidopsis thaliana (thale cress): AT1G09815Help
Entry
AT1G09815         CDS       T00041                                 

Gene name
POLD4
Definition
(RefSeq) polymerase delta 4
  KO
K03505  DNA polymerase delta subunit 4
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00230  Purine metabolism
ath00240  Pyrimidine metabolism
ath01100  Metabolic pathways
ath03030  DNA replication
ath03410  Base excision repair
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
ath03440  Homologous recombination
Module
ath_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AT1G09815 (POLD4)
   00240 Pyrimidine metabolism
    AT1G09815 (POLD4)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AT1G09815 (POLD4)
   03410 Base excision repair
    AT1G09815 (POLD4)
   03420 Nucleotide excision repair
    AT1G09815 (POLD4)
   03430 Mismatch repair
    AT1G09815 (POLD4)
   03440 Homologous recombination
    AT1G09815 (POLD4)
DNA replication proteins [BR:ath03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    AT1G09815 (POLD4)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      AT1G09815 (POLD4)
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     AT1G09815 (POLD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 837513
NCBI-ProteinID: NP_563854
MIPS: AT1G09815.1
TAIR: AT1G09815
Araport: AT1G09815
UniProt: Q1H568 A0A178WHS7
Position
1
AA seq 124 aa AA seqDB search
MATTAKNLKGFYKQTKSNITGGISKSKPSSRKVAPKHAAAQGSDVTQPAALISHGSVDLN
EDYDKEEEMLRQFDMNITYGPCLGMTRLDRWERAVRLGMNPPNEIEKLLKTGKVQQDCLW
QGRV
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgacggcgaagaatttgaagggtttctacaagcagactaaaagcaatatcacc
ggaggtatctccaagtccaagccttcttcccggaaagtggctcccaaacacgcggcggct
caaggttctgatgttacccagcccgccgcattgatttcacacggctccgtcgatctcaac
gaggattatgacaaggaggaggagatgcttagacaatttgacatgaacatcacttatggt
ccgtgcctgggtatgacgagacttgatcgatgggagcgtgcagtgcgtcttgggatgaac
cctcccaatgaaatcgagaagcttttgaagaccgggaaagtccagcaagattgtctgtgg
caaggtcgtgtctag

DBGET integrated database retrieval system