KEGG   Arabidopsis thaliana (thale cress): AT1G09815Help
Entry
AT1G09815         CDS       T00041                                 

Gene name
POLD4
Definition
DNA polymerase delta subunit 4
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AT1G09815 (POLD4)
   00240 Pyrimidine metabolism
    AT1G09815 (POLD4)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AT1G09815 (POLD4)
   03410 Base excision repair
    AT1G09815 (POLD4)
   03420 Nucleotide excision repair
    AT1G09815 (POLD4)
   03430 Mismatch repair
    AT1G09815 (POLD4)
   03440 Homologous recombination
    AT1G09815 (POLD4)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      AT1G09815 (POLD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 124 aa AA seqDB search
MATTAKNLKGFYKQTKSNITGGISKSKPSSRKVAPKHAAAQGSDVTQPAALISHGSVDLN
EDYDKEEEMLRQFDMNITYGPCLGMTRLDRWERAVRLGMNPPNEIEKLLKTGKVQQDCLW
QGRV
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgacggcgaagaatttgaagggtttctacaagcagactaaaagcaatatcacc
ggaggtatctccaagtccaagccttcttcccggaaagtggctcccaaacacgcggcggct
caaggttctgatgttacccagcccgccgcattgatttcacacggctccgtcgatctcaac
gaggattatgacaaggaggaggagatgcttagacaatttgacatgaacatcacttatggt
ccgtgcctgggtatgacgagacttgatcgatgggagcgtgcagtgcgtcttgggatgaac
cctcccaatgaaatcgagaagcttttgaagaccgggaaagtccagcaagattgtctgtgg
caaggtcgtgtctag

DBGET integrated database retrieval system