KEGG   Arabidopsis thaliana (thale cress): AT1G10600Help
Entry
AT1G10600         CDS       T00041                                 

Gene name
AMSH2
Definition
(RefSeq) associated molecule with the SH3 domain of STAM 2
  KO
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ath00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AT1G10600 (AMSH2)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AT1G10600 (AMSH2)
Peptidases [BR:ath01002]
 Metallo Peptidases
  Family M67
   AT1G10600 (AMSH2)
Membrane trafficking [BR:ath04131]
 Endosome - Lysosome transport
  Others
   Others
    AT1G10600 (AMSH2)
Ubiquitin system [BR:ath04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    AT1G10600 (AMSH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
1
AA seq 223 aa AA seqDB search
MVTLSSPSPSLSCVENVTCKSSHVSRVLISGTDNINHGESSEAKILRDVHISERLLEDFT
ELARENTEKDLETCGTLAAFLERGIFYVTTLIIPKQESTSNSCQAMNEVEVFSIQNEREL
YPVGWIHTHPSQGCFMSSVDLHTHYSYQVMVPEAFAIVVAPTDSSKSYGIFKLTDPGGME
VLRGCSETGFHPHKEPEDGNPVYEHCSNVYKNSNLRFEIFDLR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtaacgctctcgtctccatctccctcgctctcttgcgtagagaacgtgacatgtaaa
tcttctcacgtttctcgggttctaatctccggtaccgataatattaatcacggtgaatcg
tcggaagccaaaatactgagagatgttcatatctcagaaaggttattggaggatttcact
gagcttgcaagagagaacactgagaaggacctcgagacttgtgggactctcgctgccttt
cttgaaagaggaattttttatgtaaccactctgataatacctaagcaagaatcaacttct
aattcttgtcaggctatgaatgaagtggaagtgttttccattcaaaacgaaagagaactc
tatcccgtaggatggattcatactcatccttctcagggttgtttcatgtcatctgtagat
ctgcatacacattattcgtatcaggtaatggtgccagaggcttttgcaatcgtcgtagct
ccaactgatagctctaagagttacgggatatttaagctaacggaccctggaggaatggag
gtactgagaggctgctcagagactggattccacccgcacaaagaaccagaagatgggaac
ccagtttatgagcattgctcaaacgtctacaagaactcgaaccttaggttcgagattttt
gatctacgttaa

DBGET integrated database retrieval system