KEGG   Arabidopsis thaliana (thale cress): AT1G10600Help
Entry
AT1G10600         CDS       T00041                                 

Gene name
AMSH2
Definition
associated molecule with the SH3 domain of STAM 2
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ath04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 166 aa AA seqDB search
MFISQKGYWRISLSLQERTLRRTSRLVGLSLPFLVLRFSSFMNLMCQAMNEVEVFSIQNE
RELYPVGWIHTHPSQGCFMSSVDLHTHYSYQVMVPEAFAIVVAPTDSSKSYGIFKLTDPG
GMEVLRGCSETGFHPHKEPEDGNPVYEHCSNVYKNSNLRFEIFDLR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgttcatatctcagaaaggttattggaggatttcactgagcttgcaagagagaacactg
agaaggacctcgagacttgtgggactctcgctgcctttcttggttcttcgtttttcgagt
ttcatgaacctgatgtgtcaggctatgaatgaagtggaagtgttttccattcaaaacgaa
agagaactctatcccgtaggatggattcatactcatccttctcagggttgtttcatgtca
tctgtagatctgcatacacattattcgtatcaggtaatggtgccagaggcttttgcaatc
gtcgtagctccaactgatagctctaagagttacgggatatttaagctaacggaccctgga
ggaatggaggtactgagaggctgctcagagactggattccacccgcacaaagaaccagaa
gatgggaacccagtttatgagcattgctcaaacgtctacaagaactcgaaccttaggttc
gagatttttgatctacgttaa

DBGET integrated database retrieval system