KEGG   Arabidopsis thaliana (thale cress): AT1G10960Help
Entry
AT1G10960         CDS       T00041                                 

Gene name
FD1
Definition
(RefSeq) ferredoxin 1
  KO
K02639  
ferredoxin
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Photosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    AT1G10960 (FD1)
Photosynthesis proteins [BR:ath00194]
 Photosystem and electron transport system
  Photosynthetic electron transport
   AT1G10960 (FD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 148 aa AA seqDB search
MASTALSSAIVSTSFLRRQQTPISLRSLPFANTQSLFGLKSSTARGGRVTAMATYKVKFI
TPEGEQEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQ
MSEGYVLTCVAYPTSDVVIETHKEEAIM
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcttccactgctctctccagcgcaatcgtaagcacctctttcctccgccgtcaacag
acaccaatcagcctcagatccctcccgtttgccaacacacaatctctcttcggcctcaaa
tcttccaccgctcgcggcggccgcgtcacggccatggctacctacaaggtcaagttcatc
acacctgagggagaacaagaggtcgaatgcgaagaagatgtctacgtcctcgacgctgct
gaggaagccggactcgacttgccctactcatgccgtgccggttcttgctcaagttgcgcc
gggaaagtcgtctctggttctattgaccagtcggaccagagcttcttagacgatgaacag
atgagtgagggctatgtcttgacctgtgtggcttatccgacttctgatgtcgtcatcgaa
acccacaaagaagaagccattatgtaa

DBGET integrated database retrieval system