KEGG   Arabidopsis thaliana (thale cress): AT1G12270Help
Entry
AT1G12270         CDS       T00041                                 

Definition
(RefSeq) protein HOP1
  KO
K09553  
stress-induced-phosphoprotein 1
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Chaperones and folding catalysts [BR:ath03110]
 Other chaperones and cochaperones
  Sti1 / p60
   AT1G12270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 572 aa AA seqDB search
MAEEAKAKGNAAFSSGDFTTAINHFTEAIALAPTNHVLFSNRSAAHASLHQYAEALSDAK
ETIKLKPYWPKGYSRLGAAHLGLNQFELAVTAYKKGLDVDPTNEALKSGLADAEASVARS
RAAPNPFGDAFQGPEMWTKLTSDPSTRGFLQQPDFVNMMQEIQKNPSSLNLYLKDQRVMQ
SLGVLLNVKFRPPPPQGDEAEVPESDMGQSSSNEPEVEKKREPEPEPEPEVTEEKEKKER
KEKAKKEKELGNAAYKKKDFETAIQHYSTAIEIDDEDISYLTNRAAVYLEMGKYNECIED
CNKAVERGRELRSDYKMVARALTRKGTALTKMAKCSKDYEPAIEAFQKALTEHRNPDTLK
RLNDAERAKKEWEQKQYFDPKLGDEEREKGNDFFKEQKYPEAIKHYTEAIKRNPNDHKAY
SNRAASYTKLGAMPEGLKDAEKCIELDPTFSKGYSRKAAVQFFLKEYDNAMETYQAGLEH
DPSNQELLDGVKRCVQQINKANRGDLTPEELKERQAKGMQDPEIQNILTDPVMRQVLSDL
QENPSAAQKHMQNPMVMNKIQKLISAGIVQMK
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaagctaaagctaaaggaaacgctgctttctcttccggtgacttcaccacg
gctataaaccacttcaccgaagccatagctcttgctccaaccaatcacgtcctcttctca
aaccgttccgctgctcacgcgtcgcttcatcaatacgccgaagctctctccgatgcgaaa
gagacgattaaactcaaaccgtattggcctaaaggttatagccgtctcggtgctgctcat
ttagggttaaaccagtttgagttagccgtcactgcttataagaaaggtttagatgtcgat
ccgactaacgaggcgttgaaatctggattggctgatgcggaggcgtctgttgctaggtca
cgagctgcaccgaatccgtttggtgatgcttttcaaggaccggagatgtggacgaagctt
acgtctgatccttcgactagaggctttttgcagcagccggattttgttaacatgatgcag
gagattcagaagaatcctagcagtcttaatttgtatttgaaggatcagagagtgatgcaa
tctcttggagttttattgaatgttaagtttaggccaccgccgcctcagggagatgaggct
gaggttcctgagtctgatatgggtcagagttctagtaatgagcctgaggttgagaagaag
agagaaccggagcctgaaccggaaccggaggtgacagaggagaaggagaagaaagagagg
aaggagaaagctaaaaaggagaaagagcttgggaatgctgcgtataaaaagaaggacttt
gaaactgctattcagcattattctactgctattgagattgatgatgaagacatctcgtac
ctcacaaatcgtgctgctgtttatcttgagatgggaaagtacaatgagtgcattgaggat
tgtaacaaggctgtggaaaggggtagagagcttaggtcagattacaagatggtagctaga
gctttgactagaaaagggactgctttgactaagatggccaaatgctcgaaagactatgaa
cctgccattgaagctttccagaaggctcttacagagcaccgtaaccctgatacgttgaag
agacttaacgatgcggaaagagcaaagaaagagtgggaacagaagcaatatttcgatcct
aagctaggggatgaagagcgtgaaaaaggtaacgatttcttcaaggagcagaagtatcct
gaggccataaaacattacaccgaagcaatcaaaaggaacccaaatgaccataaagcatat
agcaaccgagctgctagttacactaagctaggtgcaatgcctgaaggactaaaggatgca
gaaaagtgtattgagctcgatccaaccttctctaaaggatacagcagaaaagctgcagtc
caattcttcctcaaagagtacgacaatgcgatggaaacataccaagcgggtctcgagcat
gatcctagtaatcaggaacttcttgacggtgttaaaagatgtgtacaacaaatcaacaag
gctaatcgcggagaccttactcctgaggaattgaaagagagacaggcaaagggaatgcaa
gacccagaaatccagaacatcctcacagatcctgtaatgagacaggtactgtctgatctt
caagagaatccaagcgcagcacagaagcacatgcaaaatccaatggttatgaacaagatt
caaaagcttattagcgctgggatcgtccagatgaaataa

DBGET integrated database retrieval system