KEGG   Arabidopsis thaliana (thale cress): AT1G14400Help
Entry
AT1G14400         CDS       T00041                                 

Gene name
UBC1
Definition
(RefSeq) ubiquitin-conjugating enzyme E2 1
  KO
K10573  
ubiquitin-conjugating enzyme E2 A [EC:2.3.2.23]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AT1G14400 (UBC1)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     AT1G14400 (UBC1)
Ubiquitin system [BR:ath04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   AT1G14400 (UBC1)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    AT1G14400 (UBC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
1
AA seq 152 aa AA seqDB search
MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFS
EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS
PANSEAARMYSESKREYNRRVRDVVEQSWTAD
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgccagcaaggaagaggttaatgagggatttcaagaggttgcagcaagaccca
cctgcgggtattagtggtgctccacaggacaacaacattatgctctggaatgctgtcata
tttgggcctgatgacacaccatgggatggaggtactttcaaactctcactgcagttctct
gaagattatcccaataaaccaccaacagttcggtttgtgtcacggatgtttcatcctaat
atttatgcagatgggagtatctgcttggacattctacaaaaccagtggagtccaatctat
gatgttgctgctatacttacctccatccagtccttgctctgtgaccctaatccgaattct
cctgcaaactcggaagctgctcggatgtacagcgaaagcaagcgcgagtacaacaggaga
gtgcgtgatgttgttgagcaaagctggactgctgactag

DBGET integrated database retrieval system