KEGG   Arabidopsis thaliana (thale cress): AT1G15850Help
Entry
AT1G15850         CDS       T00041                                 

Definition
WD40 domain-containing protein
Orthology
K14298  
mRNA export factor
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ath03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 140 aa AA seqDB search
MSTSGDKATSSTNNPNNSYEITPPATDSISSLSFSPKADILVATSWDCQVRCWEITRSDG
SIASEPKVSMSHDQPVLCSAWKDDGTTVFTGGCDKQAKMWPLLSGAQPSTVAMHDAPFNQ
IAWIPGMNLLVTGSWDKTLK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgtctacttccggtgataaagccacctctagcaccaataaccctaacaactcctacgag
attactccaccagccaccgactctatttcgagcttaagttttagtccaaaggccgatata
cttgtggcaacttcatgggattgtcaggtgagatgttgggaaataacccgtagtgacggc
tctatagccagtgaaccaaaggtatcaatgtctcatgatcagccggttttgtgttctgct
tggaaagatgatggaaccacagtctttaccggaggatgtgataagcaggcaaaaatgtgg
ccattgttgtctggtgctcaaccatctactgttgctatgcacgatgctcctttcaatcag
atagcttggatccctggaatgaatctccttgttactggaagctgggataaaactttgaag
taa

DBGET integrated database retrieval system