KEGG   Arabidopsis thaliana (thale cress): AT1G15990Help
Entry
AT1G15990         CDS       T00041                                 

Gene name
CNGC7
Definition
(RefSeq) cyclic nucleotide gated channel 7
  KO
K05391  
cyclic nucleotide gated channel, other eukaryote
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    AT1G15990 (CNGC7)
Ion channels [BR:ath04040]
 Related to voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   AT1G15990 (CNGC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 738 aa AA seqDB search
MYKSQYISGQREKFVRLDDIDSSSSPATGMMMQRNCFGFNLKNRGGEKKKASKSFREGVK
KIRSEGLITIGKSVTRAVFPEDLRITEKKIFDPQDKTLLVWNRLFVISCILAVSVDPLFF
YLPIVDNSGSSCIGIDTKLAVTTTTLRTIVDVFYLTRMALQFRTAYIAPSSRVFGRGELV
IDPAKIAERYLTRYFVVDFLAVLPLPQIAVWKFLHGSKGSDVLPTKTALLNIVIVQYIPR
FVRFIPLTSELKKTAGAFAEGAWAGAAYYLLWYMLASHITGAFWYMLSVERNDTCWRFAC
KVQPDPRLCVQILYCGTKFVSSGETEWIKTVPELLKSNCSAKADDSKFNYGIYGQAISSG
IVSSTTFFSKFCYCLWWGLQNLSTLGQGLQTSTFPGEVLFSIAIAIAGLLLFALLIGNMQ
TYLQSLTVRLEEMRIKRRDSEQWMHHRSLPQNLRERVRRYDQYKWLETRGVDEENIVQSL
PKDLRRDIKRHLCLNLVRRVPLFANMDERLLDAICERLKPSLFTESTYIVREGDPVNEMM
FIIRGRLESVTTDGGRSGFFNRGLLKEGDFCGEELLTWALDPKAGSNLPSSTRTVKALTE
VEAFALEAEELKFVASQFRRLHSRQVQQTFRFYSQQWRTWASCFIQAAWRRYSRRKNAEL
RRIEEKEEELGYEDEYDDESDKRPMVITRSESSSRLRSTIFASRFAANALKGHRLRSSES
SKTLINLQKPPEPDFDAE
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaatcccaatacataagcggccaaagagaaaaattcgttaggttagatgatata
gattcaagttcttctcctgcgactggaatgatgatgcagagaaactgtttcggatttaac
ctaaagaaccgaggaggtgaaaagaagaaagcatccaaatctttcagggaaggagttaaa
aaaatcagatcagaaggtctaataaccatcggtaaatccgttacaagagcggtttttcca
gaagacttaagaataacagagaagaaaatctttgatcctcaagacaaaacacttctcgta
tggaacagattgttcgtcatttcgtgtattttagctgtctctgttgatcctttgttcttc
tatcttcccattgtcgataattccggaagcagctgtatagggattgatacgaaactagct
gttacaacgacgactcttagaaccattgttgacgttttttacttaactagaatggctctt
cagtttcgtacagcttatatagctccttcttctcgtgtgtttggtcgtggtgagcttgtg
attgatcctgcaaagatcgctgaacgctatttaacccgttatttcgtcgtcgattttctt
gcagtgctgcctttaccgcagattgcagtgtggaagtttcttcacgggtctaaaggatcg
gatgtgttaccaacgaaaacggcattgttgaacattgtaattgtgcagtatattccgaga
ttcgtgaggtttattccgttaacatcagagttgaagaaaactgcaggagcttttgccgaa
ggagcttgggctggtgctgcttattatcttctctggtatatgcttgcaagccacataact
ggagcgttttggtacatgttgtcagtggagcgtaacgatacttgttggagatttgcgtgt
aaagttcagccagatccgcgactctgtgttcagattctgtattgtgggactaaatttgtg
agcagtggagaaactgaatggatcaaaacagtccctgagcttcttaagagcaattgttct
gctaaagcagatgattcaaagtttaactatgggatatacggtcaggctatatcttcaggc
attgtatcatcaacaacatttttctccaagttctgttattgtctatggtggggtcttcaa
aatctcagcacgttaggtcaagggctgcagacaagtacatttccaggagaggttttgttt
tccattgcgattgctatagctgggcttcttcttttcgcgcttctcatcgggaatatgcag
acttatcttcagtcacttactgttcgtctcgaggaaatgaggatcaaaagacgtgactca
gaacagtggatgcatcacaggtcacttccacaaaatttgagggaaagagtcagacgctat
gatcaatacaaatggttagagacaagaggtgtagacgaagaaaacatagttcagagttta
cctaaggatctcagaagagacatcaaacgccatctctgtctgaatttagttaggagggtt
cctctgtttgctaatatggatgaaagattacttgacgcaatctgtgagagattaaagccg
agtcttttcacggaaagcacttacattgtgcgtgaaggagaccccgttaacgaaatgatg
ttcataatccgaggccggttagaaagtgtaacaacagatgggggaagaagcggtttcttc
aacagagggttgttaaaagaaggagacttttgtggtgaagagcttctgacatgggctctt
gaccctaaagcaggctcaaacttaccttcttccacaagaacagtgaaggctctgactgaa
gtagaggctttcgctcttgaagctgaagagctgaagtttgtagcaagtcagtttaggaga
cttcatagtcgacaggttcaacaaacatttaggttttactctcagcaatggagaacttgg
gcttcttgcttcatccaagctgcttggcgtcgctattcaagaaggaaaaacgctgaattg
agacggattgaagaaaaagaagaagaattgggttatgaagatgaatatgatgatgagagt
gacaagaggcctatggttatcacaagaagtgagtcttcttctagactgcgttcaacgata
tttgcatcaagatttgctgctaatgcattgaaagggcacagacttaggagctcagagagt
tcaaagaccttgataaatctgcaaaagcctccggaacctgattttgatgctgaataa

DBGET integrated database retrieval system