KEGG   Arabidopsis thaliana (thale cress): AT1G15990Help
Entry
AT1G15990         CDS       T00041                                 

Gene name
CNGC7
Definition
cyclic nucleotide gated channel 7
Orthology
K05391  
cyclic nucleotide gated channel, other eukaryote
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Plant-pathogen interaction
Class
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:ath04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 709 aa AA seqDB search
MMMQRNCFGFNLKNRGGEKKKASKSFREGVKKIRSEGLITIGKSVTRAVFPEDLRITEKK
IFDPQDKTLLVWNRLFVISCILAVSVDPLFFYLPIVDNSGSSCIGIDTKLAVTTTTLRTI
VDVFYLTRMALQFRTAYIAPSSRVFGRGELVIDPAKIAERYLTRYFVVDFLAVLPLPQIA
VWKFLHGSKGSDVLPTKTALLNIVIVQYIPRFVRFIPLTSELKKTAGAFAEGAWAGAAYY
LLWYMLASHITGAFWYMLSVERNDTCWRFACKVQPDPRLCVQILYCGTKFVSSGETEWIK
TVPELLKSNCSAKADDSKFNYGIYGQAISSGIVSSTTFFSKFCYCLWWGLQNLSTLGQGL
QTSTFPGEVLFSIAIAIAGLLLFALLIGNMQTYLQSLTVRLEEMRIKRRDSEQWMHHRSL
PQNLRERVRRYDQYKWLETRGVDEENIVQSLPKDLRRDIKRHLCLNLVRRVPLFANMDER
LLDAICERLKPSLFTESTYIVREGDPVNEMMFIIRGRLESVTTDGGRSGFFNRGLLKEGD
FCGEELLTWALDPKAGSNLPSSTRTVKALTEVEAFALEAEELKFVASQFRRLHSRQVQQT
FRFYSQQWRTWASCFIQAAWRRYSRRKNAELRRIEEKEEELGYEDEYDDESDKRPMVITR
SESSSRLRSTIFASRFAANALKGHRLRSSESSKTLINLQKPPEPDFDAE
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgcagagaaactgtttcggatttaacctaaagaaccgaggaggtgaaaagaag
aaagcatccaaatctttcagggaaggagttaaaaaaatcagatcagaaggtctaataacc
atcggtaaatccgttacaagagcggtttttccagaagacttaagaataacagagaagaaa
atctttgatcctcaagacaaaacacttctcgtatggaacagattgttcgtcatttcgtgt
attttagctgtctctgttgatcctttgttcttctatcttcccattgtcgataattccgga
agcagctgtatagggattgatacgaaactagctgttacaacgacgactcttagaaccatt
gttgacgttttttacttaactagaatggctcttcagtttcgtacagcttatatagctcct
tcttctcgtgtgtttggtcgtggtgagcttgtgattgatcctgcaaagatcgctgaacgc
tatttaacccgttatttcgtcgtcgattttcttgcagtgctgcctttaccgcagattgca
gtgtggaagtttcttcacgggtctaaaggatcggatgtgttaccaacgaaaacggcattg
ttgaacattgtaattgtgcagtatattccgagattcgtgaggtttattccgttaacatca
gagttgaagaaaactgcaggagcttttgccgaaggagcttgggctggtgctgcttattat
cttctctggtatatgcttgcaagccacataactggagcgttttggtacatgttgtcagtg
gagcgtaacgatacttgttggagatttgcgtgtaaagttcagccagatccgcgactctgt
gttcagattctgtattgtgggactaaatttgtgagcagtggagaaactgaatggatcaaa
acagtccctgagcttcttaagagcaattgttctgctaaagcagatgattcaaagtttaac
tatgggatatacggtcaggctatatcttcaggcattgtatcatcaacaacatttttctcc
aagttctgttattgtctatggtggggtcttcaaaatctcagcacgttaggtcaagggctg
cagacaagtacatttccaggagaggttttgttttccattgcgattgctatagctgggctt
cttcttttcgcgcttctcatcgggaatatgcagacttatcttcagtcacttactgttcgt
ctcgaggaaatgaggatcaaaagacgtgactcagaacagtggatgcatcacaggtcactt
ccacaaaatttgagggaaagagtcagacgctatgatcaatacaaatggttagagacaaga
ggtgtagacgaagaaaacatagttcagagtttacctaaggatctcagaagagacatcaaa
cgccatctctgtctgaatttagttaggagggttcctctgtttgctaatatggatgaaaga
ttacttgacgcaatctgtgagagattaaagccgagtcttttcacggaaagcacttacatt
gtgcgtgaaggagaccccgttaacgaaatgatgttcataatccgaggccggttagaaagt
gtaacaacagatgggggaagaagcggtttcttcaacagagggttgttaaaagaaggagac
ttttgtggtgaagagcttctgacatgggctcttgaccctaaagcaggctcaaacttacct
tcttccacaagaacagtgaaggctctgactgaagtagaggctttcgctcttgaagctgaa
gagctgaagtttgtagcaagtcagtttaggagacttcatagtcgacaggttcaacaaaca
tttaggttttactctcagcaatggagaacttgggcttcttgcttcatccaagctgcttgg
cgtcgctattcaagaaggaaaaacgctgaattgagacggattgaagaaaaagaagaagaa
ttgggttatgaagatgaatatgatgatgagagtgacaagaggcctatggttatcacaaga
agtgagtcttcttctagactgcgttcaacgatatttgcatcaagatttgctgctaatgca
ttgaaagggcacagacttaggagctcagagagttcaaagaccttgataaatctgcaaaag
cctccggaacctgattttgatgctgaataa

DBGET integrated database retrieval system