KEGG   Arabidopsis thaliana (thale cress): AT1G16710Help
Entry
AT1G16710         CDS       T00041                                 

Gene name
HAC12
Definition
(RefSeq) histone acetyltransferase HAC12
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AT1G16710 (HAC12)
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    AT1G16710 (HAC12)
Chromosome [BR:ath03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    AT1G16710 (HAC12)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    AT1G16710 (HAC12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 1706 aa AA seqDB search
MNVQAHMSGQRSGQVPNQGTVPQNNGNSQMQNLVGSNGAATAVTGAGAATGSGTGVRPSR
NIVGAMDHDIMKLRQYMQTLVFNMLQQRQPSPADAASKAKYMDVARRLEEGLFKMAVTKE
DYMNRSTLESRITSLIKGRQINNYNQRHANSSSVGTMIPTPGLSQTAGNPNLMVTSSVDA
TIVGNTNITSTALNTGNPLIAGGMHGGNMSNGYQHSSRNFSLGSGGSMTSMGAQRSTAQM
IPTPGFVNSVTNNNSGGFSAEPTIVPQSQQQQQRQHTGGQNSHMLSNHMAAGVRPDMQSK
PSGAANSSVNGDVGANEKIVDSGSSYTNASKKLQQGNFSLLSFCPDDLISGQHIESTFHI
SGEGYSTTNPDPFDGAITSAGTGTKAHNINTASFQPVSRVNSSLSHQQQFQQPPNRFQQQ
PNQIQQQQQQFLNQRKLKQQTPQQHRLISNDGLGKTQVDSDMVTKVKCEPGMENKSQAPQ
SQASERFQLSQLQNQYQNSGEDCQADAQLLPVESQSDICTSLPQNSQQIQQMMHPQNIGS
DSSNSFSNLAVGVKSESSPQGQWPSKSQENTLMSNAISSGKHIQEDFRQRITGMDEAQPN
NLTEGSVIGQNHTSTISESHNLQNSIGTTCRYGNVSHDPKFKNQQRWLLFLRHARSCKPP
GGRCQDQNCVTVQKLWSHMDNCADPQCLYPRCRHTKALIGHYKNCKDPRCPVCVPVKTYQ
QQANVRALARLKNESSAVGSVNRSVVSNDSLSANAGAVSGTPRCADTLDNLQPSLKRLKV
EQSFQPVVPKTESCKSSIVSTTEADLSQDAERKDHRPLKSETMEVKVEIPDNSVQAGFGI
KETKSEPFENVPKPKPVSEPGKHGLSGDSPKQENIKMKKEPGWPKKEPGCPKKEELVESP
ELTSKSRKPKIKGVSLTELFTPEQVREHIRGLRQWVGQSKAKAEKNQAMENSMSENSCQL
CAVEKLTFEPPPIYCTPCGARIKRNAMYYTVGGGETRHYFCIPCYNESRGDTILAEGTSM
PKAKLEKKKNDEEIEESWVQCDKCQAWQHQICALFNGRRNDGGQAEYTCPYCYVIDVEQN
ERKPLLQSAVLGAKDLPRTILSDHIEQRLFKRLKQERTERARVQGTSYDEIPTVESLVVR
VVSSVDKKLEVKSRFLEIFREDNFPTEFPYKSKVVLLFQKIEGVEVCLFGMYVQEFGSEC
SNPNQRRVYLSYLDSVKYFRPDIKSANGEALRTFVYHEILIGYLEYCKLRGFTSCYIWAC
PPLKGEDYILYCHPEIQKTPKSDKLREWYLAMLRKAAKEGIVAETTNLYDHFFLQTGECR
AKVTAARLPYFDGDYWPGAAEDIISQMSQEDDGRKGNKKGILKKPITKRALKASGQSDFS
GNASKDLLLMHKLGETIHPMKEDFIMVHLQHSCTHCCTLMVTGNRWVCSQCKDFQLCDGC
YEAEQKREDRERHPVNQKDKHNIFPVEIADIPTDTKDRDEILESEFFDTRQAFLSLCQGN
HYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNVCHLDIESGLGWRCEVCPDYDVCNAC
YKKEGCINHPHKLTTHPSLADQNAQNKEARQLRVLQLRKMLDLLVHASQCRSPVCLYPNC
RKVKGLFRHGLRCKVRASGGCVLCKKMWYLLQLHARACKESECDVPRCGDLKEHLRRLQQ
QSDSRRRAAVMEMMRQRAAEVAGTSG
NT seq 5121 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttcaggctcacatgtctggtcaacggtctgggcaggttccaaaccaagggaca
gtgccgcagaataatggaaactctcaaatgcagaatttagttggtagtaatggtgctgct
actgctgttactggtgctggtgctgctactggttctggtactggtgtaaggccttcacgt
aacatcgttggtgccatggatcatgatattatgaaacttcgacagtacatgcaaactctt
gtgtttaacatgttacagcaacggcaaccatctccagctgatgctgcatcaaaggcaaag
tatatggatgttgctagacgtttagaagaagggctgtttaagatggctgtcacaaaggag
gattacatgaaccggtcaacccttgaatctcgtattacaagcctaataaaaggaagacag
ataaataactacaatcagcgacatgctaattcttcttcagttggaacgatgatacctact
ccaggattatcacagactgcgggtaatcctaatttgatggttacatcctctgttgatgct
actatagttggcaacaccaacatcacaagcactgctttgaacactggaaaccctctaatt
gctggtggcatgcatggaggtaatatgtctaatggatatcagcactcgtcgagaaacttt
tctcttggttctggagggagcatgacatccatgggtgctcaaagaagtacagcccaaatg
attcctacacctggcttcgttaacagtgttactaacaacaacagtggtggattttctgct
gagcccacaattgttcctcagtctcagcaacaacaacaaaggcaacatactggtggtcaa
aacagtcacatgttgtccaaccatatggctgctggcgttagacccgacatgcaatcaaag
ccgtcgggtgcggccaacagctctgtaaatggtgatgttggagcgaacgaaaaaattgta
gactcaggttcatcttacaccaatgcgtccaaaaaattacagcagggtaacttctctctt
ctttccttctgtccggatgatctcatttcaggtcagcatattgaaagcacgtttcatatt
tcaggggaaggttatagcacaacaaatcctgaccccttcgatggagctataacatcggct
gggacagggacaaaggctcataatatcaatacagcaagtttccagcctgtgtccagagtt
aactcttctctgtcacatcaacaacaatttcagcaaccgcctaatcgatttcagcaacaa
ccaaatcagattcaacagcagcagcagcaatttctcaatcagaggaaattgaagcagcag
actccgcagcaacatagattaataagcaatgatggcttggggaaaactcaagtggattca
gacatggttacgaaggtgaaatgtgaacctggaatggagaacaagagtcaggctccacag
tcccaagcatctgaacgattccagctttctcagctccagaatcaatatcagaactctgga
gaagactgccaagcagacgctcagcttctcccagtcgaaagtcagagtgatatatgtaca
tcactcccccaaaatagccagcagattcagcaaatgatgcacccgcagaatataggttct
gattctagtaacagttttagcaatcttgctgttggagtaaaatcagaatccagtccacag
ggtcaatggccttccaagtctcaggaaaatactctaatgtctaatgctatttcaagtgga
aagcacattcaggaggatttccgtcaaagaattaccggaatggatgaagctcaacctaat
aatttgactgaagggtctgttattggtcaaaatcatacttctactatatcggaatcccat
aatctgcaaaattctattggtaccacatgtagatatggaaacgtaagtcacgatcccaag
ttcaaaaatcaacaaagatggctactgtttctacgtcatgcacggagttgcaaaccgcca
ggagggagatgccaagatcaaaattgcgtaacagttcagaaactatggagtcacatggac
aattgtgctgatcctcagtgtttgtatccccgctgtcgtcacacaaaggcattgattggc
cactataaaaactgcaaggatcctcggtgccccgtctgtgtgccagtgaagacttatcag
caacaagctaatgttcgtgccctggcccgtttaaaaaacgaaagcagtgctgtgggctca
gtgaatagatctgtagtatcaaatgattcactaagcgctaatgctggagcggtttctggt
acccctcgttgtgctgatactttagataatttgcaaccttcattaaagcggttgaaggtg
gagcaatcttttcaaccagtggtccctaagactgaaagttgtaaaagctccattgtttct
acaacagaggcagacttatctcaggatgctgaaagaaaggatcataggccattgaagtca
gagaccatggaagtgaaagtggaaattcctgataattctgttcaagcaggattcggcatc
aaagaaacgaaaagtgaaccttttgaaaatgttcccaagcctaagcctgtcagtgaacca
ggtaaacatggtttatctggtgactcgccaaagcaagaaaacatcaaaatgaagaaagag
cctggatggccgaagaaagagcctggatgtccaaagaaagaagaactggtggagtctcct
gaacttacctcaaaatctagaaaaccaaagataaagggtgtttctttaactgaattgttt
actccggaacaagtgagagaacatatccgtggtcttcgtcagtgggttggccagagtaaa
gccaaagcagaaaagaatcaggcaatggagaattcaatgagtgagaattcctgccagtta
tgtgcggtggagaagcttacatttgagccaccacctatttattgtactccttgtggtgct
cgtatcaaaaggaatgcgatgtactatactgttggaggtggtgaaactcgtcattacttt
tgtattccctgttataatgaatcccgaggagacactattctcgctgaagggacttccatg
ccaaaggcaaaactcgagaaaaagaaaaacgatgaagagattgaagaatcgtgggtccaa
tgtgataaatgtcaggcctggcagcatcaaatatgtgctctatttaatgggcggaggaat
gatggggggcaagctgagtatacctgcccatattgctatgtaattgatgtggagcaaaat
gagagaaagcctttacttcagagtgctgttcttggagcgaaagatctgccaagaacaatt
ctcagtgaccatatagagcagcggttgtttaaaaggctgaagcaggaaaggactgagaga
gccagggttcaaggaacaagttatgatgagattccaactgttgaatcccttgtggttaga
gttgtttcatctgttgacaagaagctagaagttaaatctcgatttcttgaaatttttcgg
gaggataattttccgacagaatttccatacaagtccaaggtggttctgctgttccagaag
atagaaggtgtagaagtatgcttgtttgggatgtatgtccaagaatttggatccgaatgt
tcaaatcccaatcaacgccgtgtttatctctcgtatttggattctgtgaagtactttaga
cctgatatcaagtctgctaatggggaggctctgcgcactttcgtttaccacgaaattctt
attggttatctggaatactgcaaattgcgtggtttcacgagctgctacatatgggcttgt
ccaccactgaagggtgaggattatatcctatattgccatccagaaattcagaaaacacca
aagtctgataaactacgggaatggtacttagcaatgttgagaaaagctgcaaaggaagga
attgttgcggaaactacaaatctatatgaccattttttcttgcaaactggtgaatgtaga
gctaaggttacagcagctagactcccgtacttcgatggtgactactggccaggtgcagca
gaggatatcatatcccaaatgagtcaagaagatgatggtagaaagggaaataaaaaagga
atactcaagaaacccattacaaagagggctcttaaagcatctggccagtcggatttctct
gggaatgcttccaaagacctgctactaatgcataaacttggtgagaccattcatccaatg
aaggaggattttatcatggttcacttgcagcatagttgcacacattgctgtacgctgatg
gtaactggaaatcgttgggtttgcagccaatgcaaagatttccagttatgtgatggatgt
tatgaggctgagcagaaacgagaagacagagaaagacatcctgttaatcagaaagataaa
cataatatttttcctgttgagatcgccgatattcctacggatactaaggacagagatgag
atacttgaaagtgaattctttgatacaaggcaagcattcctgagtctatgtcaagggaac
cattatcagtatgatacactgaggcgggcaaaacattcttccatgatggtgctttatcat
ctgcataatcctactgctcctgcctttgtgacaacatgtaacgtatgtcacctcgatatt
gaaagtggtctaggctggcgctgtgaagtttgcccagactatgatgtgtgcaatgcttgt
tacaagaaagagggttgtattaatcatcctcataagttaacaactcatccatctctagct
gatcaaaacgctcagaataaagaagctaggcaattgcgagtcttgcagctcaggaaaatg
ctcgatcttctggtgcatgcgtcgcaatgccgttctccagtttgtctatatcccaactgc
cgcaaagtgaaggggctattccgacatggtctccgctgcaaagtacgtgcttcaggaggt
tgtgttctatgcaagaaaatgtggtatctgttgcaactccacgctcgggcctgcaaggaa
tccgagtgtgatgtacctcgatgcggggacctaaaggaacatctgagaaggttacaacag
caatcagattctaggcggagagctgccgtcatggagatgatgagacagagagctgcagaa
gtcgctggaacctcgggttga

DBGET integrated database retrieval system