KEGG   Arabidopsis thaliana (thale cress): AT1G17110Help
Entry
AT1G17110         CDS       T00041                                 

Gene name
UBP15
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 15
  KO
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AT1G17110 (UBP15)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AT1G17110 (UBP15)
Ubiquitin system [BR:ath04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    AT1G17110 (UBP15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 924 aa AA seqDB search
MLEPRGADIPILFLVLVVLPVVAYILLGKWSNISEKRVRANLLAQMAAEEALRAETVVNA
DRGVRFESVATENRAQRTRTKTVSAGGGAVRAEFDAGARETVAEQRSDSVTATCGVTVVA
PVNNNELHVCARCFGPAKTRCSRCKSVRYCSGKCQIIHWRVAHKDECVPVESCSSSSERV
SFEKDSVLYDHGMDSTMYSNNTTQAAKGKTSKSSVDFASLGISQNDITPQINTQGRKSVG
KQHSSKANRESCRRDSATVFDSSDEAASAGGDNKTSHIKHKSRGNSYAAETNPRRHSVDS
SAVQMNGQSFVSGMQESHKHENNLGVRSSFGCPNTQYPSNGTRTATLPRTGINKSGEQSC
TETSKKGQVAAVSKTVRSKDTGISEESNGISSTMGIMKMMGLRNSTKHDDRYKNLKMLFP
YEEFLKFFQCEVFDLSPRGLVNCGNSCYANAVLQSLTCTKPLVAYLLRRSHSRSCSGKDW
CLMCELEQHVMMLRESGGPLSASRILSHMRSINCQIGDGSQEDAHEFLRLLVASMQSICL
ERLGGETKVDPRLQETTLVQHMFGGRLRSKVKCLRCDHESERYENIMDLTLEIYGWVESL
QDALTQFTRPEDLDGENMYRCSRCAGYVRARKELSIHEAPNILTIVLKRFQEGRYGKINK
CISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKDLRGNWYRIDD
SEIHPVPMTQVMSEGAYMLFYMRSYPRPQRGEHNGKAPVHHSQPRNEMKEQRKPVNRFKP
RADHKNTESSSSEWSLFTSSDEASFTTESTRDSFSTIDYTDVCHVVDSSSPFAIFNNVYH
NVEPSPHNTVACRMFSGTKPETRYFVEQETNHNNTVVLDATPSLYPIPAPYPPHDYYDQS
MYVNYETNPEFNNGQDQDRTYSYW
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaccaaggggagcggacataccaatattgttcctggttttggttgtacttcct
gtggtagcttacattttattaggaaaatggagtaacatttctgaaaaaagagtaagggct
aacttgctggctcagatggcagctgaagaagctttaagagctgagaccgtggttaatgcg
gatagaggtgtaagatttgagagtgtggctactgagaatagggctcaaagaaccaggacc
aagactgtttctgctggtggtggtgctgtaagagcagagtttgacgctggtgcgagagaa
actgtagccgagcagagatctgattccgtgactgctacatgtggggttacagttgtggct
cctgtcaataataatgagttacatgtatgtgcaaggtgttttggtcctgctaagacacgt
tgctcgagatgtaaatctgttagatactgctccgggaagtgtcaaataattcactggagg
gtagctcacaaagatgaatgtgtcccagtggagtcttgctcttcgtcatctgagagggtt
tccttcgagaaagattctgttttgtatgaccatggcatggattctacaatgtatagtaac
aatactacgcaggcagcaaagggaaagacttcaaaaagctctgtggattttgctagcttg
ggtatctctcagaatgatattacgccacaaatcaacacgcaagggaggaaaagcgtagga
aaacaacattcttccaaggccaaccgagaatcatgtagaagagacagtgctactgtgttt
gattcttctgatgaagctgcttctgctggtggcgataacaagacgagtcacataaaacat
aagtcgagaggcaacagttatgctgcagaaacaaatcctagaaggcattctgttgacagc
tctgctgtgcaaatgaatggacaatcttttgtaagtggtatgcaggaaagtcacaaacac
gaaaacaatttgggagtcagaagctcttttggttgtccaaacacacaatatccttcaaac
gggaccagaactgcaacactgcccagaacaggtattaacaaatctggagaacagtcatgc
acagagacaagtaagaaggggcaagtcgctgcagtatcaaagactgttcggtctaaggat
actggcatcagtgaagaaagcaatggcatctcctcaacgatgggaataatgaagatgatg
ggtttaagaaattctacaaagcatgatgatcgatataagaacctgaaaatgctttttcca
tacgaggaatttcttaaattctttcagtgtgaagtgtttgatttatcacctagggggctt
gtaaattgtggaaacagttgctatgcgaacgctgttttgcaatccttaacatgtacaaaa
ccactcgttgcttatttgcttcgacgatcacattcaagatcatgttctgggaaagattgg
tgccttatgtgtgaacttgagcaacatgtaatgatgctaagagaatccggaggtccactt
tctgctagcagaattctctcacacatgcgaagtataaattgtcagattggtgatgggagt
caggaagatgctcatgagttcttaaggcttttggttgcctctatgcaatccatatgtttg
gagagacttggaggtgagactaaagtggatccgagactgcaagaaacaaccttagttcaa
catatgtttggtggacgtctccgctcaaaggttaaatgcctgaggtgtgatcatgaatca
gaaagatacgagaatataatggatctcacattagagatatacggttgggtagaatctctt
caagatgccttgactcagtttactagaccggaagatctcgacggagaaaacatgtataga
tgcagcaggtgcgctggatatgttagagcgaggaaagaattgagcattcatgaagcacca
aacattctcacaattgttcttaagcgattccaggaaggaagatacgggaaaataaacaaa
tgtataagttttcctgaaatgctagacatgattcctttcatgacaagaaccggagacgtt
cctccgctttatatgctttacgccgtcatagttcacttggatactctcaacgcatctttc
tcgggtcactacatttcgtatgtcaaagatttgagagggaattggtacagaatcgatgat
tcagagattcatccagtgccaatgactcaagttatgtcagaaggagcttacatgttgttc
tacatgagatcgtatccacgtcctcaaagaggagagcacaatggaaaagctccggttcac
cattcgcaaccaagaaacgagatgaaggaacagaggaaacctgttaaccgcttcaaaccg
agagcggatcacaagaacacagagtcatcatcaagcgaatggtctctcttcacaagctca
gacgaggcttctttcaccacagaatcaaccagagactctttcagcaccatagactacaca
gatgtttgccacgtcgtagactcttcttctcctttcgccatcttcaacaacgtataccac
aacgtagagccatcgccacacaacactgtcgcttgcagaatgttctcaggtaccaaaccc
gaaacccggtatttcgtggagcaagaaacaaatcacaacaacacggtcgtgctggacgca
acaccatcactatatcctattccagcaccgtatccgccccatgattattacgatcagagt
atgtatgtaaattacgagactaacccagaatttaacaatggtcaggatcaggatagaact
tacagttactggtag

DBGET integrated database retrieval system