KEGG   Arabidopsis thaliana (thale cress): AT1G17110Help
Entry
AT1G17110         CDS       T00041                                 

Gene name
UBP15
Definition
ubiquitin carboxyl-terminal hydrolase 15
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 928 aa AA seqDB search
MLEPRGADIPILFLVLVVLPVVAYILLGKWSNISEKRVRANLLAQMAAEEALRAETVVNA
DRGVRFESVATENRAQRTRTKTVSAGGGAVRAEFDAGARETVAEQRSDSVTATCGVTVVA
PVNNNELHVCARCFGPAKTRCSRCKSVRYCSGKCQIIHWRVAHKDECVPVESCSSSSERV
SFEKDSVLYDHGMDSTMYSNNTTQAAKGKTSKSSVDFASLGISQNDITPQINTQGRKSVG
KQHSSKANRESCRRDSATVFDSSDEAASAGGDNKTSHIKHKSRGNSYAAETNPRRHSVDS
SAVQMNGQSFVSGMQESHKHENNLGVRSSFGCPNTQYPSNGTRTATLPRTGINKSGEQSC
TETSKKGQVAAVSKTVRSKDTGISEESNGISSTMGIMKMMGLRNSTKHDDRYKNLKVSSL
MLFPYEEFLKFFQCEVFDLSPRGLVNCGNSCYANAVLQSLTCTKPLVAYLLRRSHSRSCS
GKDWCLMCELEQHVMMLRESGGPLSASRILSHMRSINCQIGDGSQEDAHEFLRLLVASMQ
SICLERLGGETKVDPRLQETTLVQHMFGGRLRSKVKCLRCDHESERYENIMDLTLEIYGW
VESLQDALTQFTRPEDLDGENMYRCSRCAGYVRARKELSIHEAPNILTIVLKRFQEGRYG
KINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKDLRGNWY
RIDDSEIHPVPMTQVMSEGAYMLFYMRSYPRPQRGEHNGKAPVHHSQPRNEMKEQRKPVN
RFKPRADHKNTESSSSEWSLFTSSDEASFTTESTRDSFSTIDYTDVCHVVDSSSPFAIFN
NVYHNVEPSPHNTVACRMFSGTKPETRYFVEQETNHNNTVVLDATPSLYPIPAPYPPHDY
YDQSMYVNYETNPEFNNGQDQDRTYSYW
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaccaaggggagcggacataccaatattgttcctggttttggttgtacttcct
gtggtagcttacattttattaggaaaatggagtaacatttctgaaaaaagagtaagggct
aacttgctggctcagatggcagctgaagaagctttaagagctgagaccgtggttaatgcg
gatagaggtgtaagatttgagagtgtggctactgagaatagggctcaaagaaccaggacc
aagactgtttctgctggtggtggtgctgtaagagcagagtttgacgctggtgcgagagaa
actgtagccgagcagagatctgattccgtgactgctacatgtggggttacagttgtggct
cctgtcaataataatgagttacatgtatgtgcaaggtgttttggtcctgctaagacacgt
tgctcgagatgtaaatctgttagatactgctccgggaagtgtcaaataattcactggagg
gtagctcacaaagatgaatgtgtcccagtggagtcttgctcttcgtcatctgagagggtt
tccttcgagaaagattctgttttgtatgaccatggcatggattctacaatgtatagtaac
aatactacgcaggcagcaaagggaaagacttcaaaaagctctgtggattttgctagcttg
ggtatctctcagaatgatattacgccacaaatcaacacgcaagggaggaaaagcgtagga
aaacaacattcttccaaggccaaccgagaatcatgtagaagagacagtgctactgtgttt
gattcttctgatgaagctgcttctgctggtggcgataacaagacgagtcacataaaacat
aagtcgagaggcaacagttatgctgcagaaacaaatcctagaaggcattctgttgacagc
tctgctgtgcaaatgaatggacaatcttttgtaagtggtatgcaggaaagtcacaaacac
gaaaacaatttgggagtcagaagctcttttggttgtccaaacacacaatatccttcaaac
gggaccagaactgcaacactgcccagaacaggtattaacaaatctggagaacagtcatgc
acagagacaagtaagaaggggcaagtcgctgcagtatcaaagactgttcggtctaaggat
actggcatcagtgaagaaagcaatggcatctcctcaacgatgggaataatgaagatgatg
ggtttaagaaattctacaaagcatgatgatcgatataagaacctgaaagttagttccctg
atgctttttccatacgaggaatttcttaaattctttcagtgtgaagtgtttgatttatca
cctagggggcttgtaaattgtggaaacagttgctatgcgaacgctgttttgcaatcctta
acatgtacaaaaccactcgttgcttatttgcttcgacgatcacattcaagatcatgttct
gggaaagattggtgccttatgtgtgaacttgagcaacatgtaatgatgctaagagaatcc
ggaggtccactttctgctagcagaattctctcacacatgcgaagtataaattgtcagatt
ggtgatgggagtcaggaagatgctcatgagttcttaaggcttttggttgcctctatgcaa
tccatatgtttggagagacttggaggtgagactaaagtggatccgagactgcaagaaaca
accttagttcaacatatgtttggtggacgtctccgctcaaaggttaaatgcctgaggtgt
gatcatgaatcagaaagatacgagaatataatggatctcacattagagatatacggttgg
gtagaatctcttcaagatgccttgactcagtttactagaccggaagatctcgacggagaa
aacatgtatagatgcagcaggtgcgctggatatgttagagcgaggaaagaattgagcatt
catgaagcaccaaacattctcacaattgttcttaagcgattccaggaaggaagatacggg
aaaataaacaaatgtataagttttcctgaaatgctagacatgattcctttcatgacaaga
accggagacgttcctccgctttatatgctttacgccgtcatagttcacttggatactctc
aacgcatctttctcgggtcactacatttcgtatgtcaaagatttgagagggaattggtac
agaatcgatgattcagagattcatccagtgccaatgactcaagttatgtcagaaggagct
tacatgttgttctacatgagatcgtatccacgtcctcaaagaggagagcacaatggaaaa
gctccggttcaccattcgcaaccaagaaacgagatgaaggaacagaggaaacctgttaac
cgcttcaaaccgagagcggatcacaagaacacagagtcatcatcaagcgaatggtctctc
ttcacaagctcagacgaggcttctttcaccacagaatcaaccagagactctttcagcacc
atagactacacagatgtttgccacgtcgtagactcttcttctcctttcgccatcttcaac
aacgtataccacaacgtagagccatcgccacacaacactgtcgcttgcagaatgttctca
ggtaccaaacccgaaacccggtatttcgtggagcaagaaacaaatcacaacaacacggtc
gtgctggacgcaacaccatcactatatcctattccagcaccgtatccgccccatgattat
tacgatcagagtatgtatgtaaattacgagactaacccagaatttaacaatggtcaggat
caggatagaacttacagttactggtag

DBGET integrated database retrieval system