KEGG   Arabidopsis thaliana (thale cress): AT1G17160Help
Entry
AT1G17160         CDS       T00041                                 

Definition
pfkB-like carbohydrate kinase family protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AT1G17160
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AT1G17160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 355 aa AA seqDB search
MMKGISSVSQSINYNPYIEFNRPQLQISTVNPNPAQSRFSRPRSLRVLSLSADPSANRNP
KSAVDAHAPPLVVVGSANADIYVEIERLPKEGETISAKTGQTLAGGKGANQAACGAKLMY
PTYFVGRLGEDAHGKLIAEALGDDGCGVHLDYVRSVNNEPTGHAVVMLQSDGQNSIIIVG
GANMKAWPEIMSDDDLEIVRNAGIVLLQREIPDSINIQVAKAVKKAGVPVILDVGGMDTP
IPNELLDSIDILSPNETELSRLTGMPTETFEQISQAVAKCHKLGVKQVLVKLGSKGSALF
IQGEKPIQQSIIPAAQVVDTTGAGDTFTAAFAVAMVEGKSHEECLRFAGCNTEHA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagggatctcttcagtttctcaatcgatcaattataatccatacatcgaattc
aatcgaccgcagcttcagatcagtactgtgaatcccaatccagctcaatctcgattttcc
cgccctcgatccctccgtgttctctcactctccgccgatccatcggcaaatcggaatcct
aaatcagccgttgacgcacacgcgccgccactggtggttgtgggatctgcgaacgccgat
atctatgtggagatcgagagattacccaaggaaggggaaacgatttcggccaagacaggg
caaacgctcgccggaggaaaaggcgcgaatcaggcggcgtgtggagcgaagctaatgtat
ccgacttacttcgttggtcgtttgggagaggacgcgcacgggaagctaatagctgaggcg
ttgggcgatgatgggtgtggggttcacttggactacgtgagatctgtgaataatgagccg
acgggacacgcggtggtgatgcttcagtcggacggtcagaattcgatcattatcgttggt
ggtgcaaatatgaaagcttggcctgagattatgagcgatgatgatcttgagattgtgagg
aatgctggtattgtgcttctgcaaagggagatcccagattccatcaatattcaagttgct
aaggctgtgaagaaagcaggtgttccagtcatccttgatgtgggaggaatggatacgcct
ataccaaatgagctattggattccattgatatcttgagccccaatgaaactgagctcagt
cgcttgacaggaatgccaactgaaacttttgaacagattagccaagctgttgcaaagtgc
cataagttgggagttaagcaagttctagtaaaactcgggtccaaaggatctgcactattc
atacaaggggaaaaaccaatccagcagtctatcataccggctgcacaagtggttgatact
acaggagctggggatactttcactgcagcatttgcagtcgctatggtagagggcaagtcc
catgaggaatgcttgagatttgctgggtgcaataccgagcatgcctga

DBGET integrated database retrieval system