KEGG   Arabidopsis thaliana (thale cress): AT1G17290Help
Entry
AT1G17290         CDS       T00041                                 

Gene name
AlaAT1
Definition
(RefSeq) alanine aminotransferas
  KO
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT1G17290 (AlaAT1)
   01210 2-Oxocarboxylic acid metabolism
    AT1G17290 (AlaAT1)
   01230 Biosynthesis of amino acids
    AT1G17290 (AlaAT1)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT1G17290 (AlaAT1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT1G17290 (AlaAT1)
   00220 Arginine biosynthesis
    AT1G17290 (AlaAT1)
Enzymes [BR:ath01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AT1G17290 (AlaAT1)
Amino acid related enzymes [BR:ath01007]
 Aminotransferase (transaminase)
  Class I
   AT1G17290 (AlaAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 543 aa AA seqDB search
MRRFVIGQAKNLIDQSRRRQLHHHKNLSFVSLIPPFSAPSDSSSRHLSSSSSSDMSASDS
SSSLPVTLDTINPKVIKCEYAVRGEIVNIAQKLQEDLKTNKDAYPFDEIIYCNIGNPQSL
GQQPITFFREVLALCSYTALLDESATHGLFSSDSIERAWKILDQIPGRATGAYSHSQGIK
GLRDAIADGIEARDGFPADPNDIFMTDGASPGVHMMMQLLITSEKDGILCPIPQYPLYSA
SIALHGGTLVPYYLDEASGWGLEISELKKQLEDARSKGITVRALAVINPGNPTGQVLSEE
NQRDVVKFCKQEGLVLLADEVYQENVYVPDKKFHSFKKVARSMGYGEKDLALVSFQSVSK
GYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLIMSPPKPGDDSYES
YIAEKDGILSSLARRAKTLEEALNKLEGVTCNRAEGAMYLFPCLHLPQKAIAAAEAEKTA
PDNFYCKRLLKATGIVVVPGSGFRQVPGTWHFRCTILPQEDKIPAIVDRLTAFHQSFMDE
FRD
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgcggagattcgtgattggccaagctaaaaatctcatagatcagagtcgtcgtcgtcaa
cttcatcatcacaaaaatctcagctttgtctctcttattcctcctttttctgctccttcc
gattcttcatcgcgccacttgtcttcttcttcttcttccgatatgtctgcttctgattcc
tcttcctctcttcccgttactcttgacaccatcaaccccaaggttatcaaatgtgagtat
gctgtccgtggagaaattgtcaacattgctcagaaattgcaagaagatttgaagactaac
aaggacgcttatccctttgatgagattatctactgtaatatcgggaatcctcaatctctt
ggtcaacagcctataacattcttcagagaggttcttgctttatgttcctacacagccctg
ttggatgagagtgcaacacacggtttgttcagttctgattcgattgagcgtgcttggaag
attctggaccaaattcccgggagagcgactggtgcttacagccacagccagggtatcaag
gggttacgtgatgcaattgctgatggaatcgaagcccgtgatggtttccctgctgatcct
aatgatatattcatgacagatggtgcaagtccaggggttcatatgatgatgcaacttctc
ataacttcagagaaagatggaatcctttgtcctattcctcagtatccattgtactcagct
tcaattgcccttcacggtggaactttggttccatactaccttgatgaagcatcaggatgg
ggtcttgaaatatctgagctgaagaaacaacttgaagatgctaggtcaaagggcatcact
gtgagagctttggctgtcattaaccctggaaacccgacagggcaggttctttcggaagaa
aaccagcgtgacgttgttaagttctgcaagcaagagggtttagttcttttagcagacgag
gtttatcaagagaatgtctatgtccctgacaaaaagttccattccttcaagaaagtagcc
cgctctatgggctacggtgagaaggatcttgccttagtctctttccaatctgtctccaaa
gggtactatggagagtgtgggaaaagaggtggttacatggaggttactggattcacttct
gatgtaagagagcagatatacaaaatggcttctgtgaatctttgttccaacatctctggt
caaattcttgctagcctcatcatgagcccacccaagcctggtgacgactcctatgaatca
tacatagcagagaaggatggaattctctcatctttggcaagacgtgcaaagactcttgaa
gaggctctgaacaagctagagggagttacatgcaatagagcagaaggagctatgtatcta
ttcccttgccttcaccttccacaaaaggcaattgcagctgctgaggcggaaaagacagca
ccagacaatttctactgcaaacgccttctaaaagctactggaatagtcgttgtccctggt
tctggctttagacaggtacctggaacatggcatttcaggtgcactatacttccccaagag
gataagattccagcgattgttgatcgtctaactgcgttccaccagagcttcatggacgag
ttccgcgactaa

DBGET integrated database retrieval system