KEGG   Arabidopsis thaliana (thale cress): AT1G17290Help
Entry
AT1G17290         CDS       T00041                                 

Gene name
AlaAT1
Definition
(RefSeq) alanine aminotransferas
  KO
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT1G17290 (AlaAT1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT1G17290 (AlaAT1)
   00220 Arginine biosynthesis
    AT1G17290 (AlaAT1)
Enzymes [BR:ath01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AT1G17290 (AlaAT1)
Amino acid related enzymes [BR:ath01007]
 Aminotransferase (transaminase)
  Class I
   AT1G17290 (AlaAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
1
AA seq 543 aa AA seqDB search
MRRFVIGQAKNLIDQSRRRQLHHHKNLSFVSLIPPFSAPSDSSSRHLSSSSSSDMSASDS
SSSLPVTLDTINPKVIKCEYAVRGEIVNIAQKLQEDLKTNKDAYPFDEIIYCNIGNPQSL
GQQPITFFREVLALCSYTALLDESATHGLFSSDSIERAWKILDQIPGRATGAYSHSQGIK
GLRDAIADGIEARDGFPADPNDIFMTDGASPGVHMMMQLLITSEKDGILCPIPQYPLYSA
SIALHGGTLVPYYLDEASGWGLEISELKKQLEDARSKGITVRALAVINPGNPTGQVLSEE
NQRDVVKFCKQEGLVLLADEVYQENVYVPDKKFHSFKKVARSMGYGEKDLALVSFQSVSK
GYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLIMSPPKPGDDSYES
YIAEKDGILSSLARRAKTLEEALNKLEGVTCNRAEGAMYLFPCLHLPQKAIAAAEAEKTA
PDNFYCKRLLKATGIVVVPGSGFRQVPGTWHFRCTILPQEDKIPAIVDRLTAFHQSFMDE
FRD
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgcggagattcgtgattggccaagctaaaaatctcatagatcagagtcgtcgtcgtcaa
cttcatcatcacaaaaatctcagctttgtctctcttattcctcctttttctgctccttcc
gattcttcatcgcgccacttgtcttcttcttcttcttccgatatgtctgcttctgattcc
tcttcctctcttcccgttactcttgacaccatcaaccccaaggttatcaaatgtgagtat
gctgtccgtggagaaattgtcaacattgctcagaaattgcaagaagatttgaagactaac
aaggacgcttatccctttgatgagattatctactgtaatatcgggaatcctcaatctctt
ggtcaacagcctataacattcttcagagaggttcttgctttatgttcctacacagccctg
ttggatgagagtgcaacacacggtttgttcagttctgattcgattgagcgtgcttggaag
attctggaccaaattcccgggagagcgactggtgcttacagccacagccagggtatcaag
gggttacgtgatgcaattgctgatggaatcgaagcccgtgatggtttccctgctgatcct
aatgatatattcatgacagatggtgcaagtccaggggttcatatgatgatgcaacttctc
ataacttcagagaaagatggaatcctttgtcctattcctcagtatccattgtactcagct
tcaattgcccttcacggtggaactttggttccatactaccttgatgaagcatcaggatgg
ggtcttgaaatatctgagctgaagaaacaacttgaagatgctaggtcaaagggcatcact
gtgagagctttggctgtcattaaccctggaaacccgacagggcaggttctttcggaagaa
aaccagcgtgacgttgttaagttctgcaagcaagagggtttagttcttttagcagacgag
gtttatcaagagaatgtctatgtccctgacaaaaagttccattccttcaagaaagtagcc
cgctctatgggctacggtgagaaggatcttgccttagtctctttccaatctgtctccaaa
gggtactatggagagtgtgggaaaagaggtggttacatggaggttactggattcacttct
gatgtaagagagcagatatacaaaatggcttctgtgaatctttgttccaacatctctggt
caaattcttgctagcctcatcatgagcccacccaagcctggtgacgactcctatgaatca
tacatagcagagaaggatggaattctctcatctttggcaagacgtgcaaagactcttgaa
gaggctctgaacaagctagagggagttacatgcaatagagcagaaggagctatgtatcta
ttcccttgccttcaccttccacaaaaggcaattgcagctgctgaggcggaaaagacagca
ccagacaatttctactgcaaacgccttctaaaagctactggaatagtcgttgtccctggt
tctggctttagacaggtacctggaacatggcatttcaggtgcactatacttccccaagag
gataagattccagcgattgttgatcgtctaactgcgttccaccagagcttcatggacgag
ttccgcgactaa

DBGET integrated database retrieval system