KEGG   Arabidopsis thaliana (thale cress): AT1G17520Help
Entry
AT1G17520         CDS       T00041                                 

Definition
(RefSeq) putative telomere repeat-binding factor 4
  KO
K09422  
myb proto-oncogene protein, plant
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    AT1G17520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 296 aa AA seqDB search
MGNQKLKWTAEEEEALLAGVRKHGPGKWKNILRDPELAEQLSSRSNIDLKDKWRNLSVAP
GIQGSKDKIRTPKIKAAAFHLAAAAAAAIVTPTHSGHSSPVATLPRSGSSDLSIDDSFNI
VVDPKNAPRYDGMIFEALSNLTDANGSDVSAIFNFIEQRQEVPPNFRRMLSSRLRRLAAQ
GKLEKVSHLKSTQNFYKMNDNSLVQRTPHVARPKESNTKSRQQTNSQGPSISQQIVEASI
TAAYKLVEVENKLDVSKGAAEEIERLMKLAEEADEMLVIAREMHEECSQGKIMYLN
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcagaagctcaaatggacggcggaggaagaggaggcgttactcgccggagtt
aggaagcatggccctggaaagtggaagaatattctccgcgatcctgaattagctgagcag
ctctctagtcgctctaacatcgacctcaaggataaatggcgtaatttaagtgttgctcct
ggtattcaaggctctaaggataagatacggacaccaaaaatcaaagctgctgcttttcat
ctggctgccgctgctgctgccgctattgtaactcctactcatagtggtcactcttctcca
gttgctactcttccccgaagtggatcttctgatttgagcattgatgatagttttaacatt
gtagttgatccaaagaatgctcccaggtatgatggaatgatatttgaagctctttcaaac
ttgacggatgctaatggatctgatgtcagcgcaattttcaacttcattgagcaacgacaa
gaagtgccaccaaatttcaggaggatgcttagttcaagattgaggaggcttgcagctcag
ggaaagcttgaaaaggttagccacttaaaatcaacacagaacttctataagatgaatgat
aatagcttggtacaaagaacaccacatgtagcgagaccaaaagagagcaacacgaaatcc
cggcagcagacaaacagtcagggaccctctatttcacagcagattgttgaagcttcaata
acagcagcttataagctcgtagaagtagagaacaaattagatgtgtcgaaaggagctgca
gaagagatagagagactgatgaaactggcagaagaggctgatgagatgctagtgatagcg
agagagatgcacgaagaatgtagtcagggaaagattatgtacttgaattga

DBGET integrated database retrieval system