KEGG   Arabidopsis thaliana (thale cress): AT1G17520Help
Entry
AT1G17520         CDS       T00041                                 

Definition
(RefSeq) Homeodomain-like/winged-helix DNA-binding family protein
  KO
K09422  transcription factor MYB, plant
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    AT1G17520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Linker_histone Myb_DNA-bind_6 Myb_DNA-binding SLIDE PP1_inhibitor 23S_rRNA_IVP CHDCT2
Motif
Other DBs
NCBI-GeneID: 838326
NCBI-ProteinID: NP_173195
MIPS: AT1G17520.1
TAIR: AT1G17520
Araport: AT1G17520
UniProt: F4I7L1 A0A178WGH1
Position
1
AA seq 296 aa AA seqDB search
MGNQKLKWTAEEEEALLAGVRKHGPGKWKNILRDPELAEQLSSRSNIDLKDKWRNLSVAP
GIQGSKDKIRTPKIKAAAFHLAAAAAAAIVTPTHSGHSSPVATLPRSGSSDLSIDDSFNI
VVDPKNAPRYDGMIFEALSNLTDANGSDVSAIFNFIEQRQEVPPNFRRMLSSRLRRLAAQ
GKLEKVSHLKSTQNFYKMNDNSLVQRTPHVARPKESNTKSRQQTNSQGPSISQQIVEASI
TAAYKLVEVENKLDVSKGAAEEIERLMKLAEEADEMLVIAREMHEECSQGKIMYLN
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcagaagctcaaatggacggcggaggaagaggaggcgttactcgccggagtt
aggaagcatggccctggaaagtggaagaatattctccgcgatcctgaattagctgagcag
ctctctagtcgctctaacatcgacctcaaggataaatggcgtaatttaagtgttgctcct
ggtattcaaggctctaaggataagatacggacaccaaaaatcaaagctgctgcttttcat
ctggctgccgctgctgctgccgctattgtaactcctactcatagtggtcactcttctcca
gttgctactcttccccgaagtggatcttctgatttgagcattgatgatagttttaacatt
gtagttgatccaaagaatgctcccaggtatgatggaatgatatttgaagctctttcaaac
ttgacggatgctaatggatctgatgtcagcgcaattttcaacttcattgagcaacgacaa
gaagtgccaccaaatttcaggaggatgcttagttcaagattgaggaggcttgcagctcag
ggaaagcttgaaaaggttagccacttaaaatcaacacagaacttctataagatgaatgat
aatagcttggtacaaagaacaccacatgtagcgagaccaaaagagagcaacacgaaatcc
cggcagcagacaaacagtcagggaccctctatttcacagcagattgttgaagcttcaata
acagcagcttataagctcgtagaagtagagaacaaattagatgtgtcgaaaggagctgca
gaagagatagagagactgatgaaactggcagaagaggctgatgagatgctagtgatagcg
agagagatgcacgaagaatgtagtcagggaaagattatgtacttgaattga

DBGET integrated database retrieval system