KEGG   Arabidopsis thaliana (thale cress): AT1G18080Help
Entry
AT1G18080         CDS       T00041                                 

Gene name
ATARCA
Definition
(RefSeq) guanine nucleotide-binding protein subunit beta-like protein A
  KO
K14753  
guanine nucleotide-binding protein subunit beta-2-like 1 protein
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     AT1G18080 (ATARCA)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT1G18080 (ATARCA)
  Exosomal proteins of colorectal cancer cells
   AT1G18080 (ATARCA)
  Exosomal proteins of bladder cancer cells
   AT1G18080 (ATARCA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 327 aa AA seqDB search
MAEGLVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRLT
GHSHFVEDVVLSSDGQFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQI
VSASRDRTIKLWNTLGECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWN
LSNCKLRSTLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLWDLAEGKKLYSLEANSVIHA
LCFSPNRYWLCAATEHGIKIWDLESKSIVEDLKVDLKAEAEKADNSGPAATKRKVIYCTS
LNWSADGSTLFSGYTDGVIRVWGIGRY
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggactcgttttgaagggcaccatgcgtgcacacactgacatggtgacggca
atcgccaccccaatcgataacgcagacatcatcgtctcagcttcccgcgacaaatccatc
attttgtggaaactcaccaaggacgacaaagcctacggtgtagctcagaggcgtctcact
ggtcactctcacttcgttgaggatgttgttctctcctccgatggacaattcgcgctttcc
ggcagctgggacggcgagctccgtctttgggatcttgctgctggtgtctccactcgtaga
ttcgttggacacaccaaggacgtgctctccgtcgccttctcactcgacaaccgtcagatc
gtctctgcatctcgtgaccgtacgatcaagctgtggaacactcttggtgagtgcaagtac
accatttcagaaggtggtgagggacaccgtgattgggttagctgcgtcagattcagccct
aacacgcttcagccgacgattgtatctgcttcgtgggacaagaccgtgaaagtgtggaac
ctttcgaactgcaagctcagatcgactcttgctggtcacaccggttacgtgagcactgtg
gctgtatcacctgatggttctctttgtgcaagtggaggcaaagacggtgttgttttgctg
tgggatttggctgaggggaagaagctttactctcttgaagctaactctgtgatccatgct
ctttgcttcagtcccaacaggtactggctctgtgctgcaactgaacatggtattaagatt
tgggaccttgagagcaagagcattgttgaggatttgaaggttgatctcaaggctgaggct
gaaaaggctgacaacagtggtcctgctgccaccaagaggaaggttatttactgcacaagc
cttaactggagcgctgatggaagcaccctcttcagtggttacaccgatggagtcattaga
gtttggggtattggtcgttactag

DBGET integrated database retrieval system