KEGG   Arabidopsis thaliana (thale cress): AT1G18360Help
Entry
AT1G18360         CDS       T00041                                 

Definition
(RefSeq) alpha/beta-Hydrolases superfamily protein
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AT1G18360
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     AT1G18360
Peptidases [BR:ath01002]
 Serine Peptidases
  Family S33
   AT1G18360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
1
AA seq 382 aa AA seqDB search
MICSSKGTVVIATRSSFPRLLNRIQNRNDVPISVIATRRSSMSVEAFPMRLKSSQKKRKM
NIGCGVSPSSPTTTVVDEEVAIRRKLAMRRVLEDNGGDGSSVRDFSLFTTKRGDTLFTQS
WTPVDSAKNRGLVVLLHGLNEHSGRYSDFAKQLNVNGFKVYGIDWIGHGGSDGLHAYVPS
LDYAVADLKSFIEKVIAENPGLPCFCIGHSTGGAIILKAMLDAKIEARVSGIVLTSPAVG
VQPTYPIFGVIAPFLSFLIPRYQLSAAKKKIMPVSRDPEALLAKYSDPLVYTGFIRARTG
NEILRLGAHLLQNLNRIKVPFLVMHGTADTVTDPKGTQKLYNEASSSDKSIKLYDGLLHD
LLFEPERETIAGVILDWLNRRV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgatctgttcaagtaaaggaacggtcgtaattgctactagaagctcatttcccagatta
ctaaaccggattcaaaatcgaaatgatgttccgattagtgtcatagctactcgacgatca
tcaatgtcggtggaggcgtttccgatgaggttaaaatcatcacagaagaagaggaagatg
aacattggttgcggtgtttccccttcttcgccgacgacgacggtggtagatgaggaagta
gccattaggcggaaattggcaatgagacgggttttggaggataacggtggcgatggaagc
tccgtcagagatttctcgctattcacgaccaagagaggtgacacgttgttcactcagtca
tggactcctgttgactccgctaagaacaggggacttgttgttctgcttcatggtctgaac
gaacacagtggcaggtatagtgattttgcaaagcagctaaatgtaaatggattcaaggtc
tatggaatagattggatcggtcatggtggaagcgatggacttcatgcttacgttccttct
cttgattatgctgtcgctgatttgaaatcgtttattgagaaggtaattgcggaaaacccg
ggattgccctgtttctgcattggccactcaacaggaggagccatcatcttaaaggctatg
ctagatgcaaagattgaagctcgagtttcagggattgtgctaacttcacccgcagttgga
gtccaaccaacttatcctatcttcggcgtaattgcaccattcctctcgttcctcataccg
agatatcagttaagtgctgcgaaaaagaaaataatgccggtttctcgtgacccggaagct
ctattggctaaatactctgacccgctagtctacactggatttatccgagcaagaaccggt
aacgagatccttagacttggtgctcatttactgcagaatctgaacagaatcaaggttccg
tttcttgtgatgcacggcacagctgatacagttactgatcctaaaggtactcagaagcta
tacaatgaggcttcctcatccgataagtcgatcaagctgtacgacgggttgttacacgat
ctgctctttgaaccagaacgggaaactatagctggagtcatattggattggctaaaccgg
cgggtttaa

DBGET integrated database retrieval system