KEGG   Arabidopsis thaliana (thale cress): AT1G18440Help
Entry
AT1G18440         CDS       T00041                                 

Definition
(RefSeq) peptidyl-tRNA hydrolase
  KO
K01056  
peptidyl-tRNA hydrolase, PTH1 family [EC:3.1.1.29]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.29  aminoacyl-tRNA hydrolase
     AT1G18440
Translation factors [BR:ath03012]
 Eukaryotic Type
  Release factors
   AT1G18440
 Prokaryotic Type
   AT1G18440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 288 aa AA seqDB search
MKAVAFPAKIANLSFPSNCCSLFFRSPATFLSPALPCRKLTKGIRGLEGLMSQCLSSSSQ
SLSFSSNSFSSQPESELLQALPSSKPKSPPLQLPWLIVGLGNPGKKYQGTRHNVGFEMVD
ALADAEGISMNTVNFKALFGKGVIGNIPIMLAKPQTFMNLSGESVGQIVSFYKIPLKQVL
VVYDDLDLPFGKLRLLPKGGHGGHNGMRSIIDRLKGSRDFPRLRIGIGRPPGKMDTANFV
LRQFNRQEQEELDHTFQTGLEAIRILLLEGFNKSATFVNTRKSMEQLS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtagcttttcccgctaaaatcgcaaatcttagcttcccttctaactgttgc
tcactattcttccgatcaccggcgacgtttttatcgccggcattgccttgtcggaagctg
acgaaaggaataagaggtctcgaaggcttgatgtctcagtgtttatcatcatcgtcacaa
tcattgtcattttcatcgaattcattctcctctcaaccggaatcagagttacttcaagct
ttaccttcttcgaagccaaaatctccgccactgcagctgccatggctcattgttggtttg
ggtaatcccggcaagaagtaccagggcacgcgccacaacgttggttttgagatggtggac
gctttggctgatgcagaaggcatctccatgaacactgttaacttcaaggccttgtttggg
aaaggcgttattggaaatataccgattatgctggctaaaccacaaactttcatgaaccta
agtggtgagtctgttggacaaatcgtttcattttacaagatcccgttaaagcaagtactt
gtggtttacgatgatttagatttgccctttggtaaactacgtttattgccaaaaggtggt
cacggaggccacaatgggatgagaagtattatagaccgcctcaaaggtagccgtgatttt
cctcgactaagaatagggatcggacgtcctccagggaagatggatacagccaattttgtt
ctccgccagttcaatagacaggaacaggaagagttggatcacacattccaaaccgggtta
gaggcaataaggattcttttgcttgaggggttcaacaaaagtgcaacatttgtcaacact
cgaaaatctatggagcaactcagttag

DBGET integrated database retrieval system