KEGG   Arabidopsis thaliana (thale cress): AT1G19050Help
Entry
AT1G19050         CDS       T00041                                 

Gene name
ARR7
Definition
(RefSeq) response regulator 7
  KO
K14492  two-component response regulator ARR-A family
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    AT1G19050 (ARR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Response_reg
Motif
Other DBs
NCBI-GeneID: 838487
NCBI-ProteinID: NP_173339
MIPS: AT1G19050.1
TAIR: AT1G19050
Araport: AT1G19050
UniProt: Q9ZWS7 Q2HIJ6
Position
1
AA seq 206 aa AA seqDB search
MAVGEVMRMEIPAGGDLTVTTPELHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRAL
QYLGLDGGKGASNLKDLKVNLIVTDYSMPGLSGYDLLKKIKESSAFREVPVVIMSSENIL
PRIQECLKEGAEEFLLKPVKLADVKRIKQLIMRNEAEECKILSHSNKRKLQEDSDTSSSS
HDDTSIKDSSCSKRMKSESENLFSLL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggcggttggtgaggtcatgaggatggagattcccgccggtggagatttgactgttact
actccggagttgcatgttcttgccgtcgatgatagtattgtggatcgtaaagtcatcgag
aggttgcttagaatctcttcttgtaaagtgacgactgtagagagtggaactagggctttg
cagtatcttggcttagatggaggcaaaggggcttctaatcttaaggatttgaaggtgaat
ttgatagtgacggattactcaatgccaggactttcaggatatgatctccttaaaaagatt
aaggaatcttcagcattcagagaagtaccagtagtgattatgtcatctgagaacatctta
cctcgtatacaagaatgtctcaaagaaggagcagaggaattcttgttgaaaccggtgaag
ctagcagatgtaaagcgaatcaaacaacttataatgaggaatgaagctgaggaatgcaaa
atcttaagccattctaacaagagaaagcttcaagaagacagtgatacatcatcatcaagt
catgatgatacttctatcaaggactcttcatgttcaaaacgaatgaaatcagaatctgaa
aaccttttttctctactttga

DBGET integrated database retrieval system