KEGG   Arabidopsis thaliana (thale cress): AT1G20140Help
Entry
AT1G20140         CDS       T00041                                 

Gene name
SK4
Definition
(RefSeq) SKP1-like protein 4
  KO
K03094  
S-phase kinase-associated protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Module
SCF-SKP2 complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AT1G20140 (SK4)
   04120 Ubiquitin mediated proteolysis
    AT1G20140 (SK4)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     AT1G20140 (SK4)
   Cul7 complex
     AT1G20140 (SK4)
Chromosome [BR:ath03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     AT1G20140 (SK4)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     AT1G20140 (SK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 163 aa AA seqDB search
MAETKKMIILKSSDGESFEIEEAVAVKSQTIKHMIEDDCADNGIPLPNVTGAILAKVIEY
CKKHVEAAAEAGGDKDFYGSAENDELKNWDSEFVKVDQPTLFDLILAANYLNIGGLLDLT
CKAVADQMRGKTPEQMRAHFNIKNDYTPEEEAEVRNENKWAFE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaacgaagaagatgatcatccttaagagctccgacggtgaatccttcgagatc
gaggaagccgtcgctgttaagtcccagacgattaagcacatgattgaggacgactgtgcc
gataacggaattccacttcccaatgtcaccggagccatcctcgccaaggttattgagtat
tgcaagaagcacgttgaagccgctgctgaagctggtggagacaaggatttctatggttcc
gctgagaacgacgagcttaagaattgggacagcgaattcgtcaaagtcgatcagcctact
ctcttcgatctcatcttggctgcgaactatttgaacatcggtggacttcttgaccttacg
tgcaaggccgtggctgatcagatgagaggcaaaactccagagcagatgcgtgcacacttc
aacatcaagaacgattacacacctgaggaagaggcggaggttcgcaatgagaacaagtgg
gcgttcgagtga

DBGET integrated database retrieval system