KEGG   Arabidopsis thaliana (thale cress): AT1G21750Help
Entry
AT1G21750         CDS       T00041                                 

Gene name
PDIL1-1
Definition
protein disulfide isomerase-like 1-1
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ath04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 501 aa AA seqDB search
MAMRGFTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCG
HCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAV
QEYNGPREAEGIVTYLKKQSGPASAEIKSADDASEVVSDKKVVVVGIFPKLSGSEFDSFM
AIAEKLRSELDFAHTSDAKLLPRGESSVTGPVVRLFKPFDEQFVDSKDFDGEALEKFVKE
SSIPLITVFDKDPNNHPYVIKFFESTNTKAMLFINFTGEGAESLKSKYREVATSNKGQGL
SFLLGDAENSQGAFQYFGLEESQVPLIIIQTADDKKYLKTNVEVDQIESWVKDFKDGKIA
PHKKSQPIPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAPILDEVAVS
YQSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDKN
KDTVGEPKKEEETTEEVKDEL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaggggcttcacgttgttttcgatccttgtgttgtctttgtgcgcttcgtct
atcagaagcgaagagacggagacgaaggagttcgtgttgaccttggatcacactaacttc
accgataccatcaacaaacacgatttcatcgtcgtcgagttctacgccccatggtgtgga
cactgcaagcagcttgctcctgagtatgagaaggctgcgtcagctttgagcagtaacgtc
ccaccagtggttcttgctaagattgatgccagtgaggaaacaaacagagaatttgcaact
caatacgaggttcagggtttcccaacaatcaagattttcagaaacggaggaaaggctgtt
caagaatacaacggacctcgtgaagctgagggtattgttacttacttgaagaaacaaagt
ggacctgcttctgctgaaattaagtcagctgatgatgcttctgaggttgttagtgacaag
aaggttgttgtggttgggattttccctaaactatctggctccgagtttgattctttcatg
gccattgctgagaaattgcgctctgagttagatttcgcacatacctcggatgccaagctt
cttccccgtggagagtcatctgtaacaggacctgtggtcaggctattcaaaccctttgat
gaacaatttgttgattccaaggatttcgatggtgaagctctggagaaatttgtcaaagaa
tccagcattccacttatcaccgtctttgacaaagatccaaacaaccacccatatgttatc
aagttctttgaaagcactaataccaaggcgatgttgttcattaacttcactggagaagga
gctgagtctcttaaatcaaagtaccgtgaagttgctacatccaacaagggacagggtctt
agcttccttctaggtgatgctgagaacagccaaggtgcattccagtactttggactcgaa
gagagccaagttcctctcatcatcatccagactgctgacgacaagaaatacctgaaaaca
aatgttgaggttgaccagattgaatcatgggtcaaggacttcaaggatggaaaaattgct
ccccacaaaaaatctcaacctatcccagccgaaaacaacgagccagtgaaggttgttgtt
tctgacagccttgacgacattgtcttaaactctggaaagaacgttttgcttgaattctat
gctccatggtgtggacactgccaaaagcttgctccaatcttggacgaagttgctgtgtcg
taccaaagcgactcaagtgtagtcatcgctaagctagatgcaaccgcaaacgacttccca
aaagatacctttgatgtgaagggattcccgaccatttacttcaaatcagcgagcggaaac
gttgtggtttacgaaggagacaggacaaaggaagatttcataagcttcgtcgacaagaac
aaggacacagttggagagcctaagaaggaggaagagacaactgaggaagtcaaggatgag
ctctga

DBGET integrated database retrieval system