KEGG   Arabidopsis thaliana (thale cress): AT1G22170Help
Entry
AT1G22170         CDS       T00041                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT1G22170
   01230 Biosynthesis of amino acids
    AT1G22170
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT1G22170
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT1G22170
Enzymes [BR:ath01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AT1G22170
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AT1G22170
  Exosomal proteins of melanoma cells
   AT1G22170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 334 aa AA seqDB search
MATATSHQSVVSFASLRSSPSSTISQCGFKIDSSLSFTSKKTNFCKIKAMASSVSYDNTL
LSPSKTIPDNSQKKSNEAALILIRHGESLWNEKNLFTGCVDVPLTEKGVEEAIEAGKRIS
NIPVDVIFTSSLIRAQMTAMLAMIQHRRKKVPIILHDESEQAKTWSQVFSDETKNQSIPV
IPAWQLNERMYGELQGLNKQETAERYGKEQVHEWRRSYDIPPPKGESLEMCAERAVAYFQ
DNIEPKLAAGKNVMIAAHGNSLRSIIMYLDKLTCQEVISLELSTGIPLLYIFKEGKFMKR
GSPVGPTEAGVYAYTKRLAQYRQKLEDDSEVLCA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggctactgctacgtctcaccaatcagtcgtttcatttgcttctctccggtcttctcct
tcttctacaatctctcaatgtggattcaagatcgattcttcactgagctttacatcgaaa
aagacaaacttttgcaagattaaagcaatggcatcatcagtttcttatgacaacactctc
ttgtctccttccaagacaatccctgacaattctcaaaagaaatcaaatgaagcagctttg
atattgattaggcatggagaatctttatggaacgagaagaatctttttactggttgtgtt
gatgtgccattgactgagaaaggtgttgaagaagctattgaagcagggaagaggattagt
aacattcctgttgatgttatctttacatcttctttgattcgtgctcagatgactgcaatg
cttgctatgattcaacaccgtcgtaagaaggtaccgatcatcttgcacgatgaaagcgaa
caggcgaaaacttggagtcaagtttttagtgatgagactaaaaaccaatccattcctgtc
atacctgcttggcagctcaatgaaagaatgtatggagaattacaaggtcttaacaagcaa
gaaacagccgagagatatgggaaagagcaagttcacgaatggcgtaggagttatgatatt
cctcctcccaaaggagagagtttggagatgtgtgctgagagagcagtagcttattttcag
gacaatatcgaaccgaagcttgcagctggaaagaacgtaatgatagctgctcacgggaac
tcgctgcggtctatcattatgtatcttgacaaattgacttgccaggaggtgataagtcta
gagctatcgacaggtatacctcttctctacatattcaaagaaggcaaattcatgaagcgg
ggaagcccggttggtccaacagaagctggtgtttatgcttataccaagagattggctcaa
tacagacagaagctagaggacgatagtgaagtactctgtgcctga

DBGET integrated database retrieval system