KEGG   Arabidopsis thaliana (thale cress): AT1G22590Help
Entry
AT1G22590         CDS       T00041                                 

Gene name
AGL87
Definition
(RefSeq) protein AGAMOUS-like 87
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 125 aa AA seqDB search
MTMAPKRCFKTNESTKSVRVACRSLRSPSVRRLSELPVEKQTKYMMDQKDLMNKMIQDAE
KKLEKEKMHTRAMKLGLMAGSNDLITDTDCSEELARAADVVDKKLKAIRERIKAVEAGAP
IIKRD
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggcaccgaaacgatgttttaaaacgaacgaatctaccaaatcggtcagagtg
gcttgcagatctttaaggagtccttccgtgagacggttaagcgaacttccggtagagaag
cagaccaaatacatgatggaccagaaggatctcatgaacaagatgatccaagacgcagag
aagaagttggagaaggagaagatgcatactcgtgcgatgaaacttgggttaatggctggg
tctaatgatctaatcaccgatactgattgttcggaggaactggccagagcagctgatgtg
gttgataagaagctcaaagccatcagagagagaatcaaggctgttgaagcaggagcacca
atcatcaagagagactag

DBGET integrated database retrieval system