KEGG   Arabidopsis thaliana (thale cress): AT1G22840Help
Entry
AT1G22840         CDS       T00041                                 

Gene name
CYTC-1
Definition
cytochrome C-1
Orthology
K08738  
cytochrome c
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ath00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 102 aa AA seqDB search
MASFDEAPPGNAKAGEKIFRTKCAQCHTVEAGAGHKQGPNLNGLFGRQSGTTAGYSYSAA
NKNKAVEWEEKALYDYLLNPKKVLHTRYQDGVPWAKEAARPC
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtttgatgaagcaccaccaggaaacgccaaggccggtgagaagatcttcagg
accaagtgtgctcagtgtcacaccgtcgaagcaggcgccggtcacaaacaaggacccaat
ctaaacggtctatttggaagacaatctggtacaactgctggttactcttactctgctgct
aacaagaacaaagctgtggaatgggaagagaaggccttgtacgattacttgctcaacccc
aagaaggttttacataccaggtaccaagatggtgttccctgggctaaagaagccgcaaga
ccgtgctga

DBGET integrated database retrieval system