KEGG   Arabidopsis thaliana (thale cress): AT1G23310Help
Entry
AT1G23310         CDS       T00041                                 

Gene name
GGT1
Definition
(RefSeq) glutamate:glyoxylate aminotransferase
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00220  Arginine biosynthesis
ath00250  Alanine, aspartate and glutamate metabolism
ath00260  Glycine, serine and threonine metabolism
ath00630  Glyoxylate and dicarboxylate metabolism
ath00710  Carbon fixation in photosynthetic organisms
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01210  2-Oxocarboxylic acid metabolism
ath01230  Biosynthesis of amino acids
Module
ath_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
ath_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT1G23310 (GGT1)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT1G23310 (GGT1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT1G23310 (GGT1)
   00260 Glycine, serine and threonine metabolism
    AT1G23310 (GGT1)
   00220 Arginine biosynthesis
    AT1G23310 (GGT1)
Enzymes [BR:ath01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AT1G23310 (GGT1)
    2.6.1.4  glycine transaminase
     AT1G23310 (GGT1)
    2.6.1.44  alanine---glyoxylate transaminase
     AT1G23310 (GGT1)
Amino acid related enzymes [BR:ath01007]
 Aminotransferase (transaminase)
  Class I
   AT1G23310 (GGT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 838940
NCBI-ProteinID: NP_564192
MIPS: AT1G23310.1
TAIR: AT1G23310
Araport: AT1G23310
UniProt: Q9LR30 A0A178WG36
Position
1
AA seq 481 aa AA seqDB search
MALKALDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVVALCQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFI
QRRDGYPSDPELIFLTDGASKGVMQILNCVIRGNGDGILVPVPQYPLYSATISLLGGTLV
PYYLDESENWGLDVANLRQSVAQARSQGITVRAMVIINPGNPTGQCLSEANIREILKFCY
NEKLVLLGDEVYQQNIYQDERPFISSKKVLMEMGSPFSKEVQLVSFHTVSKGYWGECGQR
GGYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKPGDISYDQFARESKGIL
ESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQAAKQAGKVPDVFYCLKL
LEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKFNDEFMTQYDNNFGYSK
M
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggctctcaaggcattagactacgatactctgaatgaaaacgtcaagaagtgtcagtat
gccgtaagaggtgaactttatctccgagcttctgagctgcagaaagaaggcaaaaagatt
attttcacaaacgttgggaaccctcatgctttaggacagaagccattgacatttcctcgc
caggtggttgcgctttgccaagctccgtttctactagatgacccaaatgttggaatgcta
tttccagctgatgctattgcaagagctaaacattatctttccttgacttcaggcggttta
ggtgcttacagtgattcaagaggccttccaggagttaggaaagaggttgctgagttcatt
caacggcgtgatgggtatccaagtgacccagaactcatctttctcactgatggagctagc
aaaggtgtgatgcaaatcttgaattgtgttatacgcggtaatggagatgggattctagtt
ccggttccacagtatccactttactcagctaccatatcactgttaggtggtactcttgtt
ccttactatcttgatgagtctgaaaactggggacttgatgttgctaaccttcgacaatcc
gttgctcaggctcgttctcaagggataacagtaagggcaatggtgatcattaaccctggg
aacccaactggccagtgtctaagcgaagctaacataagagagatattgaagttctgttat
aacgagaaactggttcttctgggagacgaggtttatcagcagaacatataccaggatgag
cgtccctttatcagctccaagaaggttttgatggaaatgggttcgccgttcagcaaggaa
gttcagcttgtatcttttcacacagtctctaaaggatattggggtgaatgtggacagcga
ggtggatactttgagatgaccaacctccctccaagggttgttgaggagatatacaaggtt
gcatcaattgccctcagccctaatgtctctgcgcaaatctttatgggtttgatggttaat
cctccaaagcctggagacatttcatatgaccagttcgcccgtgaaagcaaggggattctt
gaatctttgagaagaagagcaaggctcatgacagatggattcaacagctgcaaaaacgtc
gtgtgcaatttcacagaaggtgcaatgtattcgtttcctcaaatacggttaccaacggga
gctctccaagctgcaaaacaagctggaaaagtgccagacgttttctactgtctcaagctc
ttagaagccacaggaatctccacagtacctggctctggatttggacagaaagaaggtgtg
ttccatctgaggacaacaatcctgccagcagaagatgagatgccggagatcatggatagc
ttcaagaagttcaacgacgagttcatgactcagtatgataataactttggttattcgaaa
atgtga

DBGET integrated database retrieval system