KEGG   Arabidopsis thaliana (thale cress): AT1G23310Help
Entry
AT1G23310         CDS       T00041                                 

Gene name
GGT1
Definition
(RefSeq) glutamate:glyoxylate aminotransferase
  KO
K14272  
glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT1G23310 (GGT1)
   01210 2-Oxocarboxylic acid metabolism
    AT1G23310 (GGT1)
   01230 Biosynthesis of amino acids
    AT1G23310 (GGT1)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT1G23310 (GGT1)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT1G23310 (GGT1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT1G23310 (GGT1)
   00260 Glycine, serine and threonine metabolism
    AT1G23310 (GGT1)
   00220 Arginine biosynthesis
    AT1G23310 (GGT1)
Enzymes [BR:ath01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AT1G23310 (GGT1)
    2.6.1.4  glycine transaminase
     AT1G23310 (GGT1)
    2.6.1.44  alanine---glyoxylate transaminase
     AT1G23310 (GGT1)
Amino acid related enzymes [BR:ath01007]
 Aminotransferase (transaminase)
  Class I
   AT1G23310 (GGT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 481 aa AA seqDB search
MALKALDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVVALCQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFI
QRRDGYPSDPELIFLTDGASKGVMQILNCVIRGNGDGILVPVPQYPLYSATISLLGGTLV
PYYLDESENWGLDVANLRQSVAQARSQGITVRAMVIINPGNPTGQCLSEANIREILKFCY
NEKLVLLGDEVYQQNIYQDERPFISSKKVLMEMGSPFSKEVQLVSFHTVSKGYWGECGQR
GGYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKPGDISYDQFARESKGIL
ESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQAAKQAGKVPDVFYCLKL
LEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKFNDEFMTQYDNNFGYSK
M
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggctctcaaggcattagactacgatactctgaatgaaaacgtcaagaagtgtcagtat
gccgtaagaggtgaactttatctccgagcttctgagctgcagaaagaaggcaaaaagatt
attttcacaaacgttgggaaccctcatgctttaggacagaagccattgacatttcctcgc
caggtggttgcgctttgccaagctccgtttctactagatgacccaaatgttggaatgcta
tttccagctgatgctattgcaagagctaaacattatctttccttgacttcaggcggttta
ggtgcttacagtgattcaagaggccttccaggagttaggaaagaggttgctgagttcatt
caacggcgtgatgggtatccaagtgacccagaactcatctttctcactgatggagctagc
aaaggtgtgatgcaaatcttgaattgtgttatacgcggtaatggagatgggattctagtt
ccggttccacagtatccactttactcagctaccatatcactgttaggtggtactcttgtt
ccttactatcttgatgagtctgaaaactggggacttgatgttgctaaccttcgacaatcc
gttgctcaggctcgttctcaagggataacagtaagggcaatggtgatcattaaccctggg
aacccaactggccagtgtctaagcgaagctaacataagagagatattgaagttctgttat
aacgagaaactggttcttctgggagacgaggtttatcagcagaacatataccaggatgag
cgtccctttatcagctccaagaaggttttgatggaaatgggttcgccgttcagcaaggaa
gttcagcttgtatcttttcacacagtctctaaaggatattggggtgaatgtggacagcga
ggtggatactttgagatgaccaacctccctccaagggttgttgaggagatatacaaggtt
gcatcaattgccctcagccctaatgtctctgcgcaaatctttatgggtttgatggttaat
cctccaaagcctggagacatttcatatgaccagttcgcccgtgaaagcaaggggattctt
gaatctttgagaagaagagcaaggctcatgacagatggattcaacagctgcaaaaacgtc
gtgtgcaatttcacagaaggtgcaatgtattcgtttcctcaaatacggttaccaacggga
gctctccaagctgcaaaacaagctggaaaagtgccagacgttttctactgtctcaagctc
ttagaagccacaggaatctccacagtacctggctctggatttggacagaaagaaggtgtg
ttccatctgaggacaacaatcctgccagcagaagatgagatgccggagatcatggatagc
ttcaagaagttcaacgacgagttcatgactcagtatgataataactttggttattcgaaa
atgtga

DBGET integrated database retrieval system