KEGG   Arabidopsis thaliana (thale cress): AT1G24190Help
Entry
AT1G24190         CDS       T00041                                 

Gene name
SNL3
Definition
(RefSeq) paired amphipathic helix protein Sin3-like 3
  KO
K11644  
paired amphipathic helix protein Sin3a
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Chromosome [BR:ath03036]
 Eukaryotic Type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     AT1G24190 (SNL3)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    AT1G24190 (SNL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 1330 aa AA seqDB search
MVGGGSAQKLTTNDALAYLKAVKDKFQDQRGKYDEFLEVMKNFKSQRVDTAGVITRVKEL
FKGHQELILGFNTFLPKGFEITLQPEDGQPPLKKRVEFEEAISFVNKIKTRFQGDDRVYK
SFLDILNMYRRDSKSITEVYQEVAILFRDHSDLLVEFTHFLPDTSATASIPSVKTSVRER
GVSLADKKDRIITPHPDHDYGTEHIDQDRERPIKKENKEHMRGTNKENEHRDARDFEPHS
KKEQFLNKKQKLHIRGDDPAEISNQSKLSGAVPSSSTYDEKGAMKSYSQDLAIVDRVKEK
LNASEYQEFLRCLNLFSKEIISRPELQSLVGNLIGVYPDLMDSFIEFLVQCEKNEGLLSG
ILTKSKSTYLLQGEGKYPQPSLDNDRDQEHKRDDGLRDRDHEKERLEKAAANLKWAKPIS
ELDLSNCEQCTPSYRLLPKNYPISIASQKTEIGKLVLNDHWVSVTSGSEDYSFSHMRKNQ
YEESLFKCEDDRFELDMLLESVNSTTKHVEELLTKINSNELKTNSPIRVEDHLTALNLRC
IERLYGDHGLDVMDVLKKNVSLALPVILTRLKQKQEEWARCRSDFDKVWAEIYAKNYYKS
LDHRSFYFKQQDSKKLSMKALLAEIKEITEKKREDDSLLAFAAGNRLSISPDLEFDYPDH
DLHEDLYQLIKYSCAEMCSTEQLDKVMKIWTTFVEQIFGVPSRPQGAEDQEDVVKSMNQN
VKSGSSSAGESEGSPHNYASVADSRRSKSSRKANEHSQLGQTSNSERDGAAGRTSDALCE
TAQHEKMLKNVVTSDEKPESKQAVSIERAHDSTALAVDGLLDQSNGGSSIVHMTGHCNNN
LKPVTCGTELELKMNDGNGPKLEVGNKKLLTNGIAVEITSDQEMAGTSKVEREEGELSPN
GDFEEDNFAVYAKTDFETFSKANDSTGNNISGDRSREGEPSCLETRAENDAEGDENAARS
SEDSRNEYENGDVSGTESGGGEDPEDDLDNNNKGESEGEAECMADAHDAEENGSALPVSA
RFLLHVKPLVKYVPSAIALHDKDKDSLKNSQVFYGNDSFYVLFRLHRILYERILSAKVNS
SSPEGKWRTSNTKNPTDSYARFMTALYNLLDGTSDNAKFEDDCRAIIGTQSYILFTLDKL
IHKFIKHLQVVVADEMDNKLLQLYFYEKSRRPETIFDAVYYDNTRVLLPDENIYRIECRL
STPAKLSIQLMCNGLDKPDVTSVSIDPTFAAYLHNDFLSIQPNAREDRRIYLNRNKRKVC
REDEQLYSTDEVKIKNGLECKIACGSSKVSYVLETEDLLVRVKKRRKTLCHNQDSWVRQM
RLQYYKNNFL
NT seq 3993 nt NT seq  +upstreamnt  +downstreamnt
atggttggaggaggaagtgctcagaagctaactacaaacgacgctcttgcatatcttaaa
gccgtgaaggacaaatttcaggatcaacgtggaaaatatgacgagtttctcgaggttatg
aagaattttaaatctcaaagagttgatacagctggtgtgataactagggtaaaagaactt
ttcaaaggacaccaagagttgattttggggtttaatactttcttgcctaagggttttgag
atcacacttcaacctgaggatggacaacctccactgaagaaacgtgttgagtttgaggaa
gctattagctttgttaacaagattaagacaaggtttcagggagatgatcgtgtatacaaa
tcatttttagacattttaaacatgtacagaagggatagcaagtccatcactgaggtctac
caggaggttgcgatcctatttcgggatcattcagatctgctcgtggagtttactcacttt
ctacctgatacttcagcaacggcctctattccatctgttaaaacttcagttcgtgagaga
ggggtttctctggctgataagaaggaccggatcattactccacatcctgaccatgactat
ggtactgaacatattgaccaggaccgggagagacctattaagaaagaaaataaagaacac
atgagaggtactaacaaagaaaatgagcatagggatgccagagatttcgaaccacatagc
aaaaaagagcaatttctcaacaagaagcagaaactacatattagaggcgatgatcctgct
gaaatttccaatcaaagtaaactttctggagcggttcctagttcatctacttatgatgaa
aaaggtgccatgaaaagttacagtcaagatctagctattgtcgatagagtaaaggaaaag
cttaacgcctcagagtaccaggagtttttacgttgtcttaatctcttttcaaaagagata
atcagccgaccagaactgcaatctttggtagggaatttaatcggagtatatcctgacctc
atggattcctttatagagtttttggtgcaatgtgaaaagaatgaaggactgctctctggt
attctgactaagagtaagtctacttatcttttgcaaggtgaaggcaaatatcctcaaccg
tcactggacaatgatagagaccaggaacataagagagatgacgggcttagagatagagat
catgaaaaggaaaggcttgaaaaagcagctgcaaatctgaaatgggcaaagccaatcagt
gaactagatctctcgaactgtgaacaatgcactcctagttatcggttacttccaaagaat
tacccaatttctattgcaagccagaagacagagatcggtaaactggttcttaatgatcac
tgggtctccgtcacatcaggaagtgaagattattcatttagccacatgcgtaagaaccag
tatgaagagagcctcttcaaatgtgaggatgacaggtttgagctggacatgctattagag
tctgtaaattcaacgacaaagcatgtggaagaattattgacaaaaattaacagtaatgaa
ctgaaaaccaacagtcccatccgtgtcgaggatcacctcacagctctaaacttaagatgc
atagaacggttgtatggtgatcacgggctcgatgtgatggatgtgctgaagaagaacgtg
tctcttgctttacctgttatcctaacacgtttgaaacagaagcaagaagagtgggcaagg
tgtcgttctgattttgacaaagtctgggctgagatatatgctaagaattactacaagtcg
cttgatcatcgaagtttctacttcaaacagcaggattcaaagaagctgagcatgaaagca
ttgttggcagagataaaagagattactgaaaagaagcgagaggatgattcacttcttgca
tttgcagccggaaatagactatccatttccccagatttggagtttgattatccggatcat
gaccttcatgaagatctttaccagctgatcaaatattcgtgtgcagaaatgtgctctacc
gaacagttagataaggtaatgaagatttggacaactttcgtggaacaaatatttggtgtt
ccttctcgccctcaaggtgctgaagaccaagaagacgttgtcaagtccatgaaccagaat
gtaaagagcggtagttcaagtgctggcgagagtgagggaagtcctcacaattacgctagt
gttgccgactctagacgctcaaagtcatctcgaaaagctaatgaacatagtcagttgggg
caaactagtaattcggagagggatggcgccgctggtaggacatcagatgccttatgtgag
actgctcagcatgagaaaatgctgaagaatgtagttacgtctgatgaaaagcctgaaagc
aagcaagctgtttctattgagcgtgcacacgattcaactgctctcgctgtggatggatta
ttagatcaaagtaatggaggaagcagtatagtacacatgaccggacattgcaataataat
ctgaagcctgtgacctgtggaacagagttggagttgaaaatgaatgatggtaatgggcca
aaattagaggttggtaacaagaagttattgacaaatgggatcgcggtagaaataacaagt
gaccaagagatggcaggaacatccaaagttgaaagagaagaaggtgaactttctccaaat
ggagactttgaggaagataattttgcagtttatgcaaaaactgattttgagaccttcagc
aaagcgaatgatagtactggaaataacattagcggagatagaagtagagaaggggaacca
tcttgtctggagacaagggctgagaatgacgctgaaggtgacgaaaacgccgcaagatca
tcagaggacagcagaaatgaatatgagaacggtgatgtttctggaacggaatctggtggt
ggtgaagatccggaggatgatttggataacaataacaaaggagaaagcgaaggtgaggct
gaatgtatggctgatgcacatgatgctgaagaaaatgggtctgccttacccgtttcagca
cgattcttgctgcatgtaaagcccttagtaaagtatgttccttcagctatagctttgcat
gacaaggacaaagactctctgaagaactcccaagttttctatggaaatgattcgttttac
gtgcttttcaggctgcaccggatattgtatgagagaatactatcagcaaaagttaactca
tcatccccggaaggaaagtggaggacctcaaataccaaaaatcctactgattcctatgct
agattcatgactgcactctacaacttacttgatggtacatctgataatgccaagtttgaa
gatgactgccgagcgataatcgggactcagtcttatattctcttcacattggacaaactg
atccataaattcatcaagcatctacaagtagtagtagctgatgagatggacaacaagctt
cttcagctttatttttatgagaaatccagaaggcctgaaacgatttttgatgctgtgtat
tacgataatacccgtgtcctcctccctgatgagaatatttaccgtattgaatgtagatta
tcaaccccagcgaaactctctattcagcttatgtgcaacggtcttgataagcccgatgtg
acatctgtatccattgacccgacctttgcagcttatctccacaatgacttcctctccata
caaccaaatgcaagggaggatcgcagaatctatttaaataggaacaagcgcaaagtttgt
cgtgaagatgaacagttatacagcacagatgaagttaagatcaaaaatggtttggagtgt
aagatagcttgcggttcttcaaaggtctcctatgtactagaaacagaagatttgttggtg
cgagttaaaaagagaagaaaaactttgtgccacaatcaggattcttgggtaaggcaaatg
aggttacaatattacaaaaataacttcttgtga

DBGET integrated database retrieval system