KEGG   Arabidopsis thaliana (thale cress): AT1G25280Help
Entry
AT1G25280         CDS       T00041                                 

Gene name
TLP10
Definition
(RefSeq) tubby-like F-box protein 10
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
1
AA seq 445 aa AA seqDB search
MSFRGIVQDLRDGFGSLSRRSFDFRLSSLHKGKAQGSSFREYSSSRDLLSPVIVQTSRWA
NLPPELLFDVIKRLEESESNWPARKHVVACASVCRSWRAMCQEIVLGPEICGKLTFPVSL
KQPGPRDAMIQCFIKRDKSKLTFHLFLCLSPALLVENGKFLLSAKRTRRTTRTEYIISMD
ADNISRSSNSYLGKLRSNFLGTKFLVYDTQPPPNTSSSALITDRTSRSRFHSRRVSPKVP
SGSYNIAQITYELNVLGTRGPRRMHCIMNSIPISSLEPGGSVPNQPEKLVPAPYSLDDSF
RSNISFSKSSFDHRSLDFSSSRFSEMGISCDDNEEEASFRPLILKNKQPRWHEQLQCWCL
NFRGRVTVASVKNFQLVAARQPQPQGTGAAAAPTSAPAHPEQDKVILQFGKVGKDMFTMD
YRYPLSAFQAFAICLSSFDTKLACE
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttcgaggcattgttcaagatttgagagatgggtttgggagcttgtcaaggagg
agtttcgattttaggctctcgagtcttcataaagggaaagctcagggttcttcgttccgt
gagtattcgtcatcccgtgatctcttgtcgcctgtgatagttcagacaagtagatgggct
aatcttcctccagagttactctttgatgtgatcaaaagattagaggaaagtgagagtaat
tggcctgcaagaaaacatgttgtggcttgtgcttcggtttgtcggtcttggagagctatg
tgccaagagattgttttggggcctgaaatctgtgggaaactcactttccctgtttccctc
aaacagccagggcctcgtgatgcaatgattcagtgtttcatcaaaagggataaatcaaag
ctaacatttcacctttttctttgtttaagtcccgctctattagtggagaatgggaaattt
cttctttcagctaaaagaactcgtagaactactcgaaccgagtacattatctccatggat
gctgataacatctcaagatccagcaactcttacctcggaaagctcagatcaaacttcctt
gggacaaagttcttggtgtacgacacgcaaccaccaccaaacacatcttcgagcgcactt
atcactgatcgaacaagccgaagcaggtttcactccagacgagtttctcctaaagtacca
tccggaagctacaacattgctcaaatcacctatgagctcaacgtgttgggcacacgcggg
ccacgacgaatgcactgcatcatgaactccatcccaatttcatcgctcgaaccaggcggt
tcagtccctaaccaacccgagaaactcgtccctgcaccatactctctcgacgactcattc
cgcagtaacatctccttctccaaatcatcatttgaccaccgctccctcgatttcagcagt
tctagattctccgaaatgggaatatcctgcgacgacaacgaagaagaagcgagtttcaga
ccgttgattctaaagaacaagcagccaaggtggcacgagcagttgcaatgctggtgtttg
aatttccgcggacgtgtgacagttgcatcggttaagaatttccagcttgtagcagcaaga
cagccgcagcctcaagggacaggtgcagcagcagcaccaacaagtgcacctgctcaccct
gagcaagacaaggtgattctccagtttggtaaagtagggaaagatatgttcacaatggac
tataggtatccattatcggcgtttcaggcgtttgcgatatgcttaagcagctttgacacc
aagcttgcttgtgaatag

DBGET integrated database retrieval system